BLASTX nr result
ID: Cocculus23_contig00046367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046367 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517210.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002517210.1| conserved hypothetical protein [Ricinus communis] gi|223543845|gb|EEF45373.1| conserved hypothetical protein [Ricinus communis] Length = 350 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/56 (51%), Positives = 42/56 (75%), Gaps = 6/56 (10%) Frame = +2 Query: 65 GVLCRSRVVNNGVNQSN------TADSSSMEELQNAIQGAIAHCKKSLSRQQSLES 214 GVLCR+ V+N+G ++ + AD+SSMEELQ+AIQGAIAHCK S+ + +++ S Sbjct: 292 GVLCRTGVMNSGTSRVSGGGMHYAADTSSMEELQSAIQGAIAHCKNSMMQNKTMIS 347