BLASTX nr result
ID: Cocculus23_contig00046272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046272 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004488511.1| PREDICTED: genome polyprotein-like [Cicer ar... 63 4e-08 ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer ar... 62 8e-08 >ref|XP_004488511.1| PREDICTED: genome polyprotein-like [Cicer arietinum] Length = 408 Score = 63.2 bits (152), Expect = 4e-08 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 2/89 (2%) Frame = +3 Query: 24 PLFHTQFS*PPLPNQHPLPC--YTISLNPYDVDFPPLERTQNFDHHTTTRPFIQPTGITA 197 PL H + PP N +P+PC YT YD FP LER + + +++PFIQPT + Sbjct: 124 PLDHYKPLEPP-KNINPIPCVMYTAFTLKYDQQFPTLERKVDPITNRSSKPFIQPTKVQP 182 Query: 198 QGTPIPLNPSEEVLSWQTQNALTQSHYLR 284 G PL +EEVL+WQ++N + Q+ L+ Sbjct: 183 DGKLKPLTQAEEVLNWQSENMIAQNDTLQ 211 >ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer arietinum] Length = 1951 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 2/79 (2%) Frame = +3 Query: 54 PLPNQHPLPC--YTISLNPYDVDFPPLERTQNFDHHTTTRPFIQPTGITAQGTPIPLNPS 227 P N +P+PC YT YD FP LER + + +++PFIQPT + G PL + Sbjct: 456 PPKNVNPIPCFMYTAFTPGYDQQFPTLERKVDPITNRSSKPFIQPTEVQPDGKLKPLTQA 515 Query: 228 EEVLSWQTQNALTQSHYLR 284 EEVL+WQ++N + Q+ L+ Sbjct: 516 EEVLNWQSENMVAQNDSLQ 534