BLASTX nr result
ID: Cocculus23_contig00046239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046239 (576 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224904.1| hypothetical protein PRUPE_ppa022022mg [Prun... 56 8e-06 >ref|XP_007224904.1| hypothetical protein PRUPE_ppa022022mg [Prunus persica] gi|462421840|gb|EMJ26103.1| hypothetical protein PRUPE_ppa022022mg [Prunus persica] Length = 604 Score = 55.8 bits (133), Expect = 8e-06 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -1 Query: 576 LIFGHSQNGCP*EAIDLFRGMHVTDVSADQFTISGIVSAFAQLGDMNLGNQI 421 LI G+S NG EAIDLF+ M DV D++TISG++SA AQ G +NLGN + Sbjct: 280 LISGYSLNGFSREAIDLFKDMCFWDVKPDRYTISGLLSACAQTGAINLGNWV 331