BLASTX nr result
ID: Cocculus23_contig00046185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046185 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634392.1| PREDICTED: uncharacterized protein LOC100249... 71 1e-10 >ref|XP_003634392.1| PREDICTED: uncharacterized protein LOC100249003 [Vitis vinifera] Length = 221 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/63 (60%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = -1 Query: 188 MEAVLLSSTPDQSISPYKRNRNPRKVAHSFISRPSENFAPSSNINLSVHGG-LIGPPPYL 12 MEAVL+ S+P QSISPY++ RNP++ FIS+PSEN +PS NI HGG L+ PPP L Sbjct: 1 MEAVLVPSSPKQSISPYRQIRNPKRNNRRFISKPSENLSPSRNI----HGGLLLAPPPSL 56 Query: 11 SSS 3 SSS Sbjct: 57 SSS 59