BLASTX nr result
ID: Cocculus23_contig00046020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046020 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830002.1| hypothetical protein AMTR_s00251p00013890 [A... 86 7e-15 ref|XP_006833556.1| hypothetical protein AMTR_s00093p00169580 [A... 72 1e-10 ref|XP_006856736.1| hypothetical protein AMTR_s00054p00223760, p... 63 4e-08 >ref|XP_006830002.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] gi|548835726|gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +1 Query: 136 FRGIDHYSKYSKVENCCSLERRSAEVVPTISVRVWD*AFRMRKTKKCFISLVKPTPISY 312 F GIDHYS++SK ENCCSLER S E +PT VRVWD AF+M KT+K F+SL++P ISY Sbjct: 53 FIGIDHYSQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIKTQKFFVSLIEPMQISY 111 >ref|XP_006833556.1| hypothetical protein AMTR_s00093p00169580 [Amborella trichopoda] gi|548838283|gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Amborella trichopoda] Length = 131 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/48 (70%), Positives = 35/48 (72%) Frame = -1 Query: 144 PSEVTFVTTCYVHAAIFYLSKSTTLYVVYVWGDRCGGEVPHFDSRPVS 1 PS VT VT CYVHA I L KS T YVV VWGDRCG EVP F+S PVS Sbjct: 23 PSRVTLVTFCYVHAVILSLPKSITPYVVAVWGDRCGREVPQFNSHPVS 70 >ref|XP_006856736.1| hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] gi|548860636|gb|ERN18203.1| hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] Length = 67 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 136 FRGIDHYSKYSKVENCCSLERRSAEVVPTISVRVWD 243 F IDHYS++SK ENCCSLE RSA+VVPTI VRVWD Sbjct: 32 FTEIDHYSQFSKAENCCSLECRSAKVVPTIDVRVWD 67