BLASTX nr result
ID: Cocculus23_contig00045431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045431 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME50247.1| hypothetical protein DOTSEDRAFT_68952 [Dothistrom... 56 6e-06 >gb|EME50247.1| hypothetical protein DOTSEDRAFT_68952 [Dothistroma septosporum NZE10] Length = 202 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 2/36 (5%) Frame = +3 Query: 3 QAYYEKKKAARKNLAEPK--ASVPDKVKQQLEQYGY 104 QAYYEKK+AARK+LAE K A++PD VKQQLEQ+GY Sbjct: 167 QAYYEKKRAARKSLAEAKEKAAIPDNVKQQLEQFGY 202