BLASTX nr result
ID: Cocculus23_contig00045338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045338 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47644.1| hypothetical protein DOTSEDRAFT_69561 [Dothistrom... 62 6e-08 gb|EMC96286.1| hypothetical protein BAUCODRAFT_24090 [Baudoinia ... 57 3e-06 >gb|EME47644.1| hypothetical protein DOTSEDRAFT_69561 [Dothistroma septosporum NZE10] Length = 71 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -1 Query: 193 EAEKKAKPESDKYGVGGTAKDGGVSTAATVEDGGSNDAEEDGEYKP 56 E +K+A + VGGTAKDGG+STA TV DGG +DAEEDGEYKP Sbjct: 24 ENKKEAHTGNPNRNVGGTAKDGGLSTADTVADGGPDDAEEDGEYKP 69 >gb|EMC96286.1| hypothetical protein BAUCODRAFT_24090 [Baudoinia compniacensis UAMH 10762] Length = 107 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -1 Query: 187 EKKAKPESDKYGVGGTAKDGGVSTAATVEDGGSNDAEEDGEYKP 56 E AK + GVGGTA+DGG+STAATV DGG N+ ED +YKP Sbjct: 62 EANAKTSNHAPGVGGTAQDGGLSTAATVADGGPNNRAEDPDYKP 105