BLASTX nr result
ID: Cocculus23_contig00045250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045250 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC99178.1| hypothetical protein BAUCODRAFT_31509 [Baudoinia ... 59 7e-07 >gb|EMC99178.1| hypothetical protein BAUCODRAFT_31509 [Baudoinia compniacensis UAMH 10762] Length = 178 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/57 (54%), Positives = 34/57 (59%) Frame = +2 Query: 50 MSDKNTSTLQSYIDGASATAQSVLGSITGNSXXXXXXXXXXXXXXXXXXLSHTGGTI 220 MSDKNTSTLQSY+D AS QS LGSITGN+ LSHTGGT+ Sbjct: 1 MSDKNTSTLQSYVDQASGAMQSALGSITGNNADKSQGENRKAAADAKDDLSHTGGTL 57