BLASTX nr result
ID: Cocculus23_contig00045210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045210 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWG43757.1| histone H2B [Fusarium verticillioides 7600] 64 3e-08 ref|XP_001219687.1| histone H2B [Chaetomium globosum CBS 148.51]... 64 3e-08 sp|Q4HTT2.3|H2B_GIBZE RecName: Full=Histone H2B gi|558866413|gb|... 64 3e-08 gb|ETS85468.1| Histone H2B [Pestalotiopsis fici W106-1] 64 3e-08 gb|ESZ90649.1| histone H2B [Sclerotinia borealis F-4157] 64 3e-08 emb|CCX06335.1| Similar to Histone H2B; acc. no. Q0CBD1 [Pyronem... 64 3e-08 gb|EQK99463.1| Histone H2B [Ophiocordyceps sinensis CO18] 64 3e-08 emb|CCU74996.1| histone 2B [Blumeria graminis f. sp. hordei DH14] 64 3e-08 gb|EPQ62221.1| hypothetical protein BGT96224_A20112 [Blumeria gr... 64 3e-08 gb|EOO02542.1| putative histone h2b protein [Togninia minima UCR... 64 3e-08 ref|XP_007584397.1| putative histone h2b protein [Neofusicoccum ... 64 3e-08 gb|EMR69572.1| putative histone h2b protein [Eutypa lata UCREL1] 64 3e-08 gb|EMF09034.1| histone H2B [Sphaerulina musiva SO2202] 64 3e-08 gb|EME77616.1| hypothetical protein MYCFIDRAFT_53931 [Pseudocerc... 64 3e-08 gb|EME39936.1| histone H2B like protein [Dothistroma septosporum... 64 3e-08 gb|EMC99637.1| hypothetical protein BAUCODRAFT_30007 [Baudoinia ... 64 3e-08 ref|XP_007285348.1| histone h2b [Colletotrichum gloeosporioides ... 64 3e-08 ref|XP_002999954.1| histone H2B [Verticillium alfalfae VaMs.102]... 64 3e-08 sp|Q8J1K2.3|H2B_ROSNE RecName: Full=Histone H2B gi|27531291|dbj|... 64 3e-08 gb|EKG10734.1| Histone H2B [Macrophomina phaseolina MS6] 64 3e-08 >gb|EWG43757.1| histone H2B [Fusarium verticillioides 7600] Length = 138 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 107 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 138 >ref|XP_001219687.1| histone H2B [Chaetomium globosum CBS 148.51] gi|110279006|sp|Q2HH38.3|H2B_CHAGB RecName: Full=Histone H2B gi|88184763|gb|EAQ92231.1| histone H2B [Chaetomium globosum CBS 148.51] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >sp|Q4HTT2.3|H2B_GIBZE RecName: Full=Histone H2B gi|558866413|gb|ESU16496.1| histone H2B [Fusarium graminearum PH-1] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >gb|ETS85468.1| Histone H2B [Pestalotiopsis fici W106-1] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >gb|ESZ90649.1| histone H2B [Sclerotinia borealis F-4157] Length = 139 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 108 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 139 >emb|CCX06335.1| Similar to Histone H2B; acc. no. Q0CBD1 [Pyronema omphalodes CBS 100304] Length = 139 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 108 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 139 >gb|EQK99463.1| Histone H2B [Ophiocordyceps sinensis CO18] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >emb|CCU74996.1| histone 2B [Blumeria graminis f. sp. hordei DH14] Length = 132 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 101 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 132 >gb|EPQ62221.1| hypothetical protein BGT96224_A20112 [Blumeria graminis f. sp. tritici 96224] Length = 135 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 104 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 135 >gb|EOO02542.1| putative histone h2b protein [Togninia minima UCRPA7] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >ref|XP_007584397.1| putative histone h2b protein [Neofusicoccum parvum UCRNP2] gi|485922786|gb|EOD48114.1| putative histone h2b protein [Neofusicoccum parvum UCRNP2] Length = 138 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 107 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 138 >gb|EMR69572.1| putative histone h2b protein [Eutypa lata UCREL1] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >gb|EMF09034.1| histone H2B [Sphaerulina musiva SO2202] Length = 140 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 109 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 140 >gb|EME77616.1| hypothetical protein MYCFIDRAFT_53931 [Pseudocercospora fijiensis CIRAD86] Length = 139 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 108 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 139 >gb|EME39936.1| histone H2B like protein [Dothistroma septosporum NZE10] Length = 139 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 108 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 139 >gb|EMC99637.1| hypothetical protein BAUCODRAFT_30007 [Baudoinia compniacensis UAMH 10762] Length = 141 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 110 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 141 >ref|XP_007285348.1| histone h2b [Colletotrichum gloeosporioides Nara gc5] gi|429850314|gb|ELA25602.1| histone h2b [Colletotrichum gloeosporioides Nara gc5] gi|530474038|gb|EQB54346.1| histone H2B [Colletotrichum gloeosporioides Cg-14] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >ref|XP_002999954.1| histone H2B [Verticillium alfalfae VaMs.102] gi|389637389|ref|XP_003716332.1| histone H2B [Magnaporthe oryzae 70-15] gi|544604123|sp|P0CT13.1|H2B_MAGO7 RecName: Full=Histone H2B gi|544604125|sp|L7I1W3.1|H2B_MAGOY RecName: Full=Histone H2B gi|58257463|gb|AAW69353.1| histone H2B-like protein [Magnaporthe grisea] gi|261361136|gb|EEY23564.1| histone H2B [Verticillium alfalfae VaMs.102] gi|346975629|gb|EGY19081.1| histone H2B [Verticillium dahliae VdLs.17] gi|351642151|gb|EHA50013.1| histone H2B [Magnaporthe oryzae 70-15] gi|440467302|gb|ELQ36532.1| histone H2B [Magnaporthe oryzae Y34] gi|440478909|gb|ELQ59707.1| histone H2B [Magnaporthe oryzae P131] Length = 137 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 106 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 137 >sp|Q8J1K2.3|H2B_ROSNE RecName: Full=Histone H2B gi|27531291|dbj|BAC54259.1| histone H2B [Rosellinia necatrix] Length = 136 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 105 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 136 >gb|EKG10734.1| Histone H2B [Macrophomina phaseolina MS6] Length = 166 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 410 QTSVRLVLPGELAKHAVSEGTKAVTKYSSSTK 315 QTSVRL+LPGELAKHAVSEGTKAVTKYSSSTK Sbjct: 135 QTSVRLILPGELAKHAVSEGTKAVTKYSSSTK 166