BLASTX nr result
ID: Cocculus23_contig00045156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045156 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276556.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_007032420.1| Tetratricopeptide repeat (TPR)-like superfam... 86 4e-15 ref|XP_006338491.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_004147489.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_004232248.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 gb|EYU34118.1| hypothetical protein MIMGU_mgv1a003395mg [Mimulus... 83 4e-14 ref|XP_003601624.1| Pentatricopeptide repeat-containing protein ... 83 5e-14 ref|XP_003552765.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_003538522.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_002517447.1| pentatricopeptide repeat-containing protein,... 82 6e-14 ref|NP_198814.1| pentatricopeptide repeat-containing protein [Ar... 81 2e-13 ref|XP_007163838.1| hypothetical protein PHAVU_001G268500g [Phas... 81 2e-13 ref|XP_006405566.1| hypothetical protein EUTSA_v10028245mg [Eutr... 81 2e-13 ref|XP_002870737.1| pentatricopeptide repeat-containing protein ... 81 2e-13 ref|XP_006482520.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_006431055.1| hypothetical protein CICLE_v10011224mg [Citr... 80 2e-13 ref|XP_004502213.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_006286056.1| hypothetical protein CARUB_v10007588mg [Caps... 80 3e-13 gb|EXB47690.1| hypothetical protein L484_010474 [Morus notabilis] 79 5e-13 ref|XP_007215021.1| hypothetical protein PRUPE_ppa003340mg [Prun... 78 1e-12 >ref|XP_002276556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vitis vinifera] gi|296087770|emb|CBI35026.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/58 (75%), Positives = 54/58 (93%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q ++LDHS++M+EL++SISQTS +QELY+LMSPYK RQLS+RFMVSLLSREPDWQRS Sbjct: 81 QRVVHLDHSVDMDELLASISQTSNEQELYSLMSPYKGRQLSIRFMVSLLSREPDWQRS 138 >ref|XP_007032420.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508711449|gb|EOY03346.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 672 Score = 86.3 bits (212), Expect = 4e-15 Identities = 46/87 (52%), Positives = 56/87 (64%) Frame = -1 Query: 263 SSSSSSYKHVWXXXXXXXXXXXXXXXXXHQNQLYLDHSINMNELMSSISQTSTQQELYAL 84 SSSSS K +W QN +LDHSI+M EL +SIS+T ++L+ L Sbjct: 53 SSSSSPTKDIWRRSKTAPFYRPKPS----QNSTFLDHSIDMEELFASISKTQNGKDLFTL 108 Query: 83 MSPYKNRQLSLRFMVSLLSREPDWQRS 3 +SPYK RQLS+RFMVSLLSRE DWQRS Sbjct: 109 LSPYKTRQLSIRFMVSLLSRETDWQRS 135 >ref|XP_006338491.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Solanum tuberosum] Length = 668 Score = 85.1 bits (209), Expect = 9e-15 Identities = 44/87 (50%), Positives = 59/87 (67%), Gaps = 1/87 (1%) Frame = -1 Query: 260 SSSSSYKHVWXXXXXXXXXXXXXXXXXH-QNQLYLDHSINMNELMSSISQTSTQQELYAL 84 S++SS K VW + Q+ +LDHS++M++L+SSI QT+ + EL+AL Sbjct: 47 SATSSTKDVWRKTTPPFSPSQHRPYRRNPQSNSFLDHSVDMDDLLSSIGQTTNEHELFAL 106 Query: 83 MSPYKNRQLSLRFMVSLLSREPDWQRS 3 MSPYK R LS+RFMV+LLSRE DWQRS Sbjct: 107 MSPYKGRNLSMRFMVTLLSRESDWQRS 133 >ref|XP_004147489.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Cucumis sativus] gi|449530101|ref|XP_004172035.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Cucumis sativus] Length = 680 Score = 85.1 bits (209), Expect = 9e-15 Identities = 45/94 (47%), Positives = 60/94 (63%), Gaps = 7/94 (7%) Frame = -1 Query: 263 SSSSSSYKHVWXXXXXXXXXXXXXXXXXHQNQ-------LYLDHSINMNELMSSISQTST 105 +SSSS+ K +W +Q +LDHSI+M+EL++SI QT Sbjct: 49 ASSSSTSKDIWRRQTPSEKSTTTLLPQKYQRSGRRPRESSHLDHSIDMDELLASIGQTKN 108 Query: 104 QQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 +QELY+++SPYK R+LS+RFMVSLLSRE DWQRS Sbjct: 109 EQELYSVLSPYKGRELSMRFMVSLLSRESDWQRS 142 >ref|XP_004232248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Solanum lycopersicum] Length = 665 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/58 (65%), Positives = 50/58 (86%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q+ +LDHS++M++L+SSI QT+ + EL+ALMSPYK R LS+RFMV+LLSRE DWQRS Sbjct: 73 QSTSFLDHSVDMDDLLSSIGQTANEHELFALMSPYKGRNLSMRFMVTLLSRESDWQRS 130 >gb|EYU34118.1| hypothetical protein MIMGU_mgv1a003395mg [Mimulus guttatus] Length = 588 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/54 (70%), Positives = 48/54 (88%) Frame = -1 Query: 164 YLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 ++DHS++M+EL+SSI QTS + EL+AL+SPYK R LS+RFMVSLLSRE DWQRS Sbjct: 14 FIDHSVDMDELLSSIGQTSDEHELFALLSPYKCRNLSIRFMVSLLSREADWQRS 67 >ref|XP_003601624.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355490672|gb|AES71875.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 684 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/58 (60%), Positives = 49/58 (84%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q Y+D S++MNEL++SI+QT ++LY+++SPY RQLS+RFM+S+LSREPDWQRS Sbjct: 86 QQSPYMDRSVDMNELLTSIAQTQNIEQLYSILSPYNGRQLSIRFMISILSREPDWQRS 143 >ref|XP_003552765.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Glycine max] Length = 658 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/58 (63%), Positives = 47/58 (81%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 + Q Y D S++M EL+++I QT + ELYA+MSPY RQLS+RFMVSLLSREPDWQR+ Sbjct: 61 RRQQYWDRSVDMEELLAAIGQTQNEDELYAVMSPYNGRQLSMRFMVSLLSREPDWQRA 118 >ref|XP_003538522.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Glycine max] Length = 667 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/80 (50%), Positives = 50/80 (62%) Frame = -1 Query: 242 KHVWXXXXXXXXXXXXXXXXXHQNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNR 63 K VW + Q YLD S++M L+++I QT + ELYA+MSPY R Sbjct: 48 KDVWTRTSSSNTSRQRSSSSSRRQQQYLDRSVDMEVLLAAIGQTQNEDELYAVMSPYNGR 107 Query: 62 QLSLRFMVSLLSREPDWQRS 3 QLS+RFMVSLLSREPDWQR+ Sbjct: 108 QLSMRFMVSLLSREPDWQRA 127 >ref|XP_002517447.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543458|gb|EEF44989.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 654 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = -1 Query: 164 YLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 YLDHS++M +L+ SISQT + ELY+L+SPYK RQLS+RFMVSL+S+E DWQRS Sbjct: 64 YLDHSVDMKQLLISISQTQNEVELYSLLSPYKERQLSIRFMVSLISQEADWQRS 117 >ref|NP_198814.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171449|sp|Q9FLD8.1|PP408_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39980, chloroplastic; Flags: Precursor gi|10176990|dbj|BAB10222.1| unnamed protein product [Arabidopsis thaliana] gi|332007115|gb|AED94498.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 678 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/58 (62%), Positives = 50/58 (86%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q +LDH+++M+EL++SI QT ++EL++L+S YK+RQLS+RFMVSLLSRE DWQRS Sbjct: 81 QRSAFLDHNVDMDELLASIHQTQNEKELFSLLSTYKDRQLSIRFMVSLLSRENDWQRS 138 >ref|XP_007163838.1| hypothetical protein PHAVU_001G268500g [Phaseolus vulgaris] gi|561037302|gb|ESW35832.1| hypothetical protein PHAVU_001G268500g [Phaseolus vulgaris] Length = 677 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/58 (62%), Positives = 47/58 (81%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q +LD S++M EL+++I +T + ELYA+MSPY RQLS+RFMVSLLSREPDWQR+ Sbjct: 80 QQATFLDRSMDMEELLAAIGETQNEDELYAVMSPYSGRQLSMRFMVSLLSREPDWQRT 137 >ref|XP_006405566.1| hypothetical protein EUTSA_v10028245mg [Eutrema salsugineum] gi|557106704|gb|ESQ47019.1| hypothetical protein EUTSA_v10028245mg [Eutrema salsugineum] Length = 683 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/58 (62%), Positives = 49/58 (84%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q +LDH ++M++L++SI QT +QEL++L+S YK+RQLS+RFMVSLLSRE DWQRS Sbjct: 86 QRSSFLDHKVDMDDLLASIHQTQNEQELFSLLSSYKDRQLSIRFMVSLLSREKDWQRS 143 >ref|XP_002870737.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316573|gb|EFH46996.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 680 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/58 (62%), Positives = 50/58 (86%) Frame = -1 Query: 176 QNQLYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 Q +LDH+++M+EL++SI QT ++EL++L+S YK+RQLS+RFMVSLLSRE DWQRS Sbjct: 83 QRSAFLDHNVDMDELLASIHQTQNEKELFSLLSTYKDRQLSIRFMVSLLSRENDWQRS 140 >ref|XP_006482520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Citrus sinensis] Length = 677 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/55 (65%), Positives = 50/55 (90%) Frame = -1 Query: 167 LYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 ++LDHS++MNEL+ SIS+T + EL+AL+SPYK+RQLS+RFMVSLL+RE ++QRS Sbjct: 83 VHLDHSVDMNELLKSISETQNEHELFALLSPYKDRQLSIRFMVSLLTREQNYQRS 137 >ref|XP_006431055.1| hypothetical protein CICLE_v10011224mg [Citrus clementina] gi|557533112|gb|ESR44295.1| hypothetical protein CICLE_v10011224mg [Citrus clementina] Length = 677 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/55 (65%), Positives = 50/55 (90%) Frame = -1 Query: 167 LYLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 ++LDHS++MNEL+ SIS+T + EL+AL+SPYK+RQLS+RFMVSLL+RE ++QRS Sbjct: 83 VHLDHSVDMNELLKSISETQNEHELFALLSPYKDRQLSIRFMVSLLTREQNYQRS 137 >ref|XP_004502213.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Cicer arietinum] Length = 669 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -1 Query: 164 YLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 YLD ++NMNEL++SI QT Q+L+A+MSPY LS+RFMVSLLSREPDWQR+ Sbjct: 75 YLDRTVNMNELLTSIGQTQNVQQLHAVMSPYNGTNLSIRFMVSLLSREPDWQRA 128 >ref|XP_006286056.1| hypothetical protein CARUB_v10007588mg [Capsella rubella] gi|482554761|gb|EOA18954.1| hypothetical protein CARUB_v10007588mg [Capsella rubella] Length = 679 Score = 80.1 bits (196), Expect = 3e-13 Identities = 43/89 (48%), Positives = 56/89 (62%), Gaps = 2/89 (2%) Frame = -1 Query: 263 SSSSSSYKHVWXXXXXXXXXXXXXXXXXH--QNQLYLDHSINMNELMSSISQTSTQQELY 90 SSSSS K VW Q +LDH ++M+EL++SI QT ++EL+ Sbjct: 52 SSSSSQTKKVWTKQQPEKKNSSTTLRKHRRYQRSAFLDHDVDMDELLASIHQTQNEKELF 111 Query: 89 ALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 +L+S YK+ QLS+RFMVSLLSRE DWQRS Sbjct: 112 SLLSSYKDGQLSIRFMVSLLSRENDWQRS 140 >gb|EXB47690.1| hypothetical protein L484_010474 [Morus notabilis] Length = 688 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -1 Query: 164 YLDHSINMNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 YLDHS++M+EL+ SI QT +QEL++++SPYK RQLS++FMV +LSRE DWQRS Sbjct: 96 YLDHSVDMDELLRSIWQTQNEQELFSVLSPYKGRQLSIKFMVLVLSRETDWQRS 149 >ref|XP_007215021.1| hypothetical protein PRUPE_ppa003340mg [Prunus persica] gi|462411171|gb|EMJ16220.1| hypothetical protein PRUPE_ppa003340mg [Prunus persica] Length = 584 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 143 MNELMSSISQTSTQQELYALMSPYKNRQLSLRFMVSLLSREPDWQRS 3 M+EL+SSI QT +QELY+LMS YK RQLS+RFMVSLLSREPDWQRS Sbjct: 1 MDELLSSIGQTQNEQELYSLMSTYKGRQLSIRFMVSLLSREPDWQRS 47