BLASTX nr result
ID: Cocculus23_contig00045121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045121 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992354.1| hypothetical protein Salmi_Mp138 (mitochondr... 57 3e-06 >ref|YP_008992354.1| hypothetical protein Salmi_Mp138 (mitochondrion) [Salvia miltiorrhiza] gi|534292380|gb|AGU16672.1| hypothetical protein Salmi_Mp138 (mitochondrion) [Salvia miltiorrhiza] Length = 111 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 191 WNGPAQ*RKVLVRDAFHLYESRTYHARPDV 280 W P Q RKV+VRDAFHLYESRTYHARPDV Sbjct: 3 WPSPKQKRKVIVRDAFHLYESRTYHARPDV 32