BLASTX nr result
ID: Cocculus23_contig00045049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045049 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278837.2| PREDICTED: LOW QUALITY PROTEIN: putative pen... 63 5e-08 emb|CBI17645.3| unnamed protein product [Vitis vinifera] 63 5e-08 emb|CAN82640.1| hypothetical protein VITISV_028821 [Vitis vinifera] 63 5e-08 ref|XP_002325903.2| hypothetical protein POPTR_0019s08060g [Popu... 62 1e-07 ref|XP_006660314.1| PREDICTED: GDT1-like protein 4-like [Oryza b... 61 1e-07 ref|XP_006840886.1| hypothetical protein AMTR_s00087p00047450 [A... 61 1e-07 ref|XP_004973981.1| PREDICTED: GDT1-like protein 4-like [Setaria... 61 1e-07 ref|XP_007029388.1| Uncharacterized protein isoform 2, partial [... 61 1e-07 ref|XP_007029387.1| Uncharacterized protein isoform 1 [Theobroma... 61 1e-07 ref|NP_001062312.1| Os08g0528500 [Oryza sativa Japonica Group] g... 61 1e-07 tpg|DAA48176.1| TPA: hypothetical protein ZEAMMB73_131539 [Zea m... 61 1e-07 ref|XP_003572431.1| PREDICTED: GDT1-like protein 4-like [Brachyp... 61 1e-07 ref|XP_002444709.1| hypothetical protein SORBIDRAFT_07g026430 [S... 61 1e-07 ref|XP_002514857.1| pentatricopeptide repeat-containing protein,... 61 1e-07 ref|NP_001141271.1| hypothetical protein precursor [Zea mays] gi... 61 1e-07 gb|EAZ43426.1| hypothetical protein OsJ_28031 [Oryza sativa Japo... 61 1e-07 sp|A2YXC7.1|GDT14_ORYSI RecName: Full=GDT1-like protein 4; Flags... 61 1e-07 gb|EYU39706.1| hypothetical protein MIMGU_mgv1a011038mg [Mimulus... 60 3e-07 gb|EXC29930.1| GDT1-like protein 3 [Morus notabilis] 59 5e-07 gb|ABK23677.1| unknown [Picea sitchensis] gi|224286876|gb|ACN411... 59 5e-07 >ref|XP_002278837.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g23330 [Vitis vinifera] Length = 1008 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV Sbjct: 153 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 182 >emb|CBI17645.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV Sbjct: 153 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 182 >emb|CAN82640.1| hypothetical protein VITISV_028821 [Vitis vinifera] Length = 291 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV Sbjct: 153 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 182 >ref|XP_002325903.2| hypothetical protein POPTR_0019s08060g [Populus trichocarpa] gi|550316993|gb|EEF00285.2| hypothetical protein POPTR_0019s08060g [Populus trichocarpa] Length = 235 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSK+SQKKEMEEV Sbjct: 97 VLYAFFGLRLLYIAWRSDSKSSQKKEMEEV 126 >ref|XP_006660314.1| PREDICTED: GDT1-like protein 4-like [Oryza brachyantha] Length = 291 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 153 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 182 >ref|XP_006840886.1| hypothetical protein AMTR_s00087p00047450 [Amborella trichopoda] gi|548842741|gb|ERN02561.1| hypothetical protein AMTR_s00087p00047450 [Amborella trichopoda] Length = 304 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSK SQKKEMEEV Sbjct: 166 VLYAFFGLRLLYIAWRSDSKTSQKKEMEEV 195 >ref|XP_004973981.1| PREDICTED: GDT1-like protein 4-like [Setaria italica] Length = 285 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 147 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 176 >ref|XP_007029388.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] gi|508717993|gb|EOY09890.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] Length = 231 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 125 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 154 >ref|XP_007029387.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508717992|gb|EOY09889.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 293 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 155 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 184 >ref|NP_001062312.1| Os08g0528500 [Oryza sativa Japonica Group] gi|75136025|sp|Q6ZIB9.1|GDT14_ORYSJ RecName: Full=GDT1-like protein 4; Flags: Precursor gi|42407963|dbj|BAD09101.1| putative transmembrane protein(TPA regulated locus protein) [Oryza sativa Japonica Group] gi|113624281|dbj|BAF24226.1| Os08g0528500 [Oryza sativa Japonica Group] gi|215766897|dbj|BAG99125.1| unnamed protein product [Oryza sativa Japonica Group] Length = 282 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 144 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 173 >tpg|DAA48176.1| TPA: hypothetical protein ZEAMMB73_131539 [Zea mays] Length = 232 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 145 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 174 >ref|XP_003572431.1| PREDICTED: GDT1-like protein 4-like [Brachypodium distachyon] Length = 289 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 151 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 180 >ref|XP_002444709.1| hypothetical protein SORBIDRAFT_07g026430 [Sorghum bicolor] gi|241941059|gb|EES14204.1| hypothetical protein SORBIDRAFT_07g026430 [Sorghum bicolor] Length = 292 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 154 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 183 >ref|XP_002514857.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545908|gb|EEF47411.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 832 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSK SQKKEMEEV Sbjct: 145 VLYAFFGLRLLYIAWRSDSKVSQKKEMEEV 174 >ref|NP_001141271.1| hypothetical protein precursor [Zea mays] gi|194703684|gb|ACF85926.1| unknown [Zea mays] gi|414869618|tpg|DAA48175.1| TPA: hypothetical protein ZEAMMB73_131539 [Zea mays] Length = 283 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 145 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 174 >gb|EAZ43426.1| hypothetical protein OsJ_28031 [Oryza sativa Japonica Group] Length = 244 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 106 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 135 >sp|A2YXC7.1|GDT14_ORYSI RecName: Full=GDT1-like protein 4; Flags: Precursor gi|125562290|gb|EAZ07738.1| hypothetical protein OsI_29993 [Oryza sativa Indica Group] Length = 281 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSDSKASQKKE+EEV Sbjct: 143 VLYAFFGLRLLYIAWRSDSKASQKKEIEEV 172 >gb|EYU39706.1| hypothetical protein MIMGU_mgv1a011038mg [Mimulus guttatus] Length = 294 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAW+SDSKASQKKE+EEV Sbjct: 156 VLYAFFGLRLLYIAWKSDSKASQKKEIEEV 185 >gb|EXC29930.1| GDT1-like protein 3 [Morus notabilis] Length = 292 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSD K SQKKEMEEV Sbjct: 156 VLYAFFGLRLLYIAWRSDPKGSQKKEMEEV 185 >gb|ABK23677.1| unknown [Picea sitchensis] gi|224286876|gb|ACN41141.1| unknown [Picea sitchensis] Length = 302 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 499 VLYAFFGLRLLYIAWRSDSKASQKKEMEEV 410 VLYAFFGLRLLYIAWRSD+K SQKKEMEEV Sbjct: 164 VLYAFFGLRLLYIAWRSDAKNSQKKEMEEV 193