BLASTX nr result
ID: Cocculus23_contig00044629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00044629 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC77009.1| hypothetical protein OsI_15342 [Oryza sativa Indi... 59 9e-07 >gb|EEC77009.1| hypothetical protein OsI_15342 [Oryza sativa Indica Group] Length = 815 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/67 (43%), Positives = 39/67 (58%) Frame = -2 Query: 331 FLHFINQANLVDIGYFGSKFT*SNH*KGEQ*ILQRLDRCSAMPSWMELFPSTTIKYF*GP 152 F H++N L+D+GY G +T SN G+ +LQRLDRC A W FP+TT+ + Sbjct: 27 FKHYVNNIGLMDLGYNGPAYTWSNKQHGKDLVLQRLDRCLANVEWCMNFPNTTVYHLPML 86 Query: 151 RSDHLAI 131 SDH I Sbjct: 87 YSDHAPI 93