BLASTX nr result
ID: Cocculus23_contig00044300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00044300 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB88402.1| hypothetical protein L484_007685 [Morus notabilis] 70 3e-10 ref|XP_002272219.1| PREDICTED: gibberellin 2-beta-dioxygenase 1-... 63 5e-08 ref|XP_002528301.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_003519400.1| PREDICTED: uncharacterized protein LOC100785... 58 2e-06 ref|XP_007141756.1| hypothetical protein PHAVU_008G223100g [Phas... 57 2e-06 ref|XP_003616656.1| Gibberellin 2-beta-dioxygenase [Medicago tru... 57 2e-06 ref|XP_004240932.1| PREDICTED: uncharacterized protein LOC101250... 57 3e-06 >gb|EXB88402.1| hypothetical protein L484_007685 [Morus notabilis] Length = 371 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 EEQQEEDNIQVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 EE +EE+ ++FN FSFEDYAWRVYHERFP KDPLDRYR Sbjct: 331 EECEEEEEKRLFNSFSFEDYAWRVYHERFPIKDPLDRYR 369 >ref|XP_002272219.1| PREDICTED: gibberellin 2-beta-dioxygenase 1-like [Vitis vinifera] Length = 382 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 3 EEQQEEDNIQVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 EE++E+D +F FSFEDYAWR+YHER KDPLDRYR Sbjct: 343 EEEEEDDERPLFRSFSFEDYAWRIYHERLLLKDPLDRYR 381 >ref|XP_002528301.1| conserved hypothetical protein [Ricinus communis] gi|223532256|gb|EEF34059.1| conserved hypothetical protein [Ricinus communis] Length = 435 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 10/49 (20%) Frame = +3 Query: 3 EEQQEED-----NI-----QVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 EE++EED N+ ++FN FSFEDYAWRVYHE F KDPLD+YR Sbjct: 384 EEEEEEDEKDGKNVVKKEKRMFNSFSFEDYAWRVYHEPFIFKDPLDKYR 432 >ref|XP_003519400.1| PREDICTED: uncharacterized protein LOC100785042 [Glycine max] Length = 360 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 15 EEDNIQVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 EE +VFN F FEDYAWRVYHER KDPLDRYR Sbjct: 324 EELEKRVFNSFDFEDYAWRVYHERILFKDPLDRYR 358 >ref|XP_007141756.1| hypothetical protein PHAVU_008G223100g [Phaseolus vulgaris] gi|561014889|gb|ESW13750.1| hypothetical protein PHAVU_008G223100g [Phaseolus vulgaris] Length = 371 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +3 Query: 15 EEDNIQVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 EE+ +VFN F FEDYAWRVYHE KDPLDRYR Sbjct: 333 EEEEERVFNSFDFEDYAWRVYHELIIFKDPLDRYR 367 >ref|XP_003616656.1| Gibberellin 2-beta-dioxygenase [Medicago truncatula] gi|355517991|gb|AES99614.1| Gibberellin 2-beta-dioxygenase [Medicago truncatula] Length = 379 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +3 Query: 3 EEQQEEDNI------QVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 + +EE+NI +VFN FEDYAWRVYHER KDPLDRYR Sbjct: 332 DNDEEENNIGGEGQKRVFNSIDFEDYAWRVYHERLLFKDPLDRYR 376 >ref|XP_004240932.1| PREDICTED: uncharacterized protein LOC101250999 [Solanum lycopersicum] Length = 380 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +3 Query: 18 EDNIQVFNPFSFEDYAWRVYHERFPSKDPLDRYR 119 E+ Q+FN FSFEDYAWRVYHER KDPL RYR Sbjct: 346 EEESQMFNSFSFEDYAWRVYHERLILKDPLVRYR 379