BLASTX nr result
ID: Cocculus23_contig00044200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00044200 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB50278.1| hypothetical protein L484_017815 [Morus notabilis] 72 1e-10 ref|XP_003551891.1| PREDICTED: probable folate-biopterin transpo... 72 1e-10 ref|XP_003532118.1| PREDICTED: probable folate-biopterin transpo... 72 1e-10 ref|XP_007146440.1| hypothetical protein PHAVU_006G040600g [Phas... 71 1e-10 ref|XP_007020911.1| Major facilitator superfamily protein isofor... 70 2e-10 ref|XP_007020910.1| Major facilitator superfamily protein isofor... 70 2e-10 ref|XP_006401519.1| hypothetical protein EUTSA_v10013383mg [Eutr... 70 3e-10 ref|XP_006280355.1| hypothetical protein CARUB_v10026288mg [Caps... 70 3e-10 ref|XP_007213110.1| hypothetical protein PRUPE_ppa023611mg [Prun... 70 3e-10 ref|XP_002864360.1| integral membrane transporter family protein... 70 3e-10 ref|NP_200297.2| probable folate-biopterin transporter 4 [Arabid... 70 3e-10 ref|XP_004500047.1| PREDICTED: probable folate-biopterin transpo... 69 7e-10 ref|XP_004294365.1| PREDICTED: probable folate-biopterin transpo... 69 7e-10 ref|XP_003600052.1| hypothetical protein MTR_3g051190 [Medicago ... 69 7e-10 ref|XP_006452279.1| hypothetical protein CICLE_v10008106mg [Citr... 69 9e-10 ref|XP_006452278.1| hypothetical protein CICLE_v10008106mg [Citr... 69 9e-10 gb|EYU33630.1| hypothetical protein MIMGU_mgv1a005060mg [Mimulus... 68 1e-09 ref|XP_004251469.1| PREDICTED: probable folate-biopterin transpo... 68 2e-09 ref|XP_006367537.1| PREDICTED: probable folate-biopterin transpo... 67 2e-09 ref|XP_006377846.1| hypothetical protein POPTR_0011s14050g [Popu... 67 2e-09 >gb|EXB50278.1| hypothetical protein L484_017815 [Morus notabilis] Length = 496 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD+LKLSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRLKLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_003551891.1| PREDICTED: probable folate-biopterin transporter 4-like isoform X1 [Glycine max] Length = 493 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT+ISYQLKD LKLSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTSISYQLKDNLKLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_003532118.1| PREDICTED: probable folate-biopterin transporter 4-like [Glycine max] Length = 493 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT+ISYQLKD LKLSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTSISYQLKDNLKLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_007146440.1| hypothetical protein PHAVU_006G040600g [Phaseolus vulgaris] gi|561019663|gb|ESW18434.1| hypothetical protein PHAVU_006G040600g [Phaseolus vulgaris] Length = 488 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT ISYQLKD LKLSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAISYQLKDNLKLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_007020911.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] gi|508720539|gb|EOY12436.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao] Length = 385 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD++KLSP ASQ +FS+AFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRIKLSPSASQFVFSIAFFPWSIKPIY 69 >ref|XP_007020910.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] gi|508720538|gb|EOY12435.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao] Length = 496 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD++KLSP ASQ +FS+AFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRIKLSPSASQFVFSIAFFPWSIKPIY 69 >ref|XP_006401519.1| hypothetical protein EUTSA_v10013383mg [Eutrema salsugineum] gi|557102609|gb|ESQ42972.1| hypothetical protein EUTSA_v10013383mg [Eutrema salsugineum] Length = 488 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD+L+LSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRLQLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_006280355.1| hypothetical protein CARUB_v10026288mg [Capsella rubella] gi|482549059|gb|EOA13253.1| hypothetical protein CARUB_v10026288mg [Capsella rubella] Length = 492 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD+L+LSP ASQ +FSVAFFPWSI Y Sbjct: 29 GFRSFVWTAVSYQLKDRLQLSPSASQFVFSVAFFPWSIKPLY 70 >ref|XP_007213110.1| hypothetical protein PRUPE_ppa023611mg [Prunus persica] gi|462408975|gb|EMJ14309.1| hypothetical protein PRUPE_ppa023611mg [Prunus persica] Length = 497 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD+LKLSP +SQ +FS+AFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRLKLSPSSSQFVFSIAFFPWSIKPLY 69 >ref|XP_002864360.1| integral membrane transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297310195|gb|EFH40619.1| integral membrane transporter family protein [Arabidopsis lyrata subsp. lyrata] Length = 491 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD+L+LSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRLQLSPSASQFVFSVAFFPWSIKPLY 69 >ref|NP_200297.2| probable folate-biopterin transporter 4 [Arabidopsis thaliana] gi|75158734|sp|Q8RWQ5.1|FBT4_ARATH RecName: Full=Probable folate-biopterin transporter 4 gi|20147215|gb|AAM10323.1| AT5g54860/MBG8_12 [Arabidopsis thaliana] gi|332009167|gb|AED96550.1| probable folate-biopterin transporter 4 [Arabidopsis thaliana] Length = 491 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD+L+LSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDRLQLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_004500047.1| PREDICTED: probable folate-biopterin transporter 4-like [Cicer arietinum] Length = 497 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT ISYQLKD L LSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAISYQLKDNLHLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_004294365.1| PREDICTED: probable folate-biopterin transporter 4-like [Fragaria vesca subsp. vesca] Length = 494 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD LKLSP +SQ +FS+AFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDTLKLSPSSSQFVFSIAFFPWSIKPLY 69 >ref|XP_003600052.1| hypothetical protein MTR_3g051190 [Medicago truncatula] gi|355489100|gb|AES70303.1| hypothetical protein MTR_3g051190 [Medicago truncatula] Length = 495 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT ISYQLKD L LSP ASQ +FSVAFFPWSI Y Sbjct: 28 GFRSFVWTAISYQLKDNLHLSPSASQFVFSVAFFPWSIKPLY 69 >ref|XP_006452279.1| hypothetical protein CICLE_v10008106mg [Citrus clementina] gi|557555505|gb|ESR65519.1| hypothetical protein CICLE_v10008106mg [Citrus clementina] Length = 474 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKDKLKLSP ASQ + +VAFFPWSI Y Sbjct: 5 GFRSFVWTAVSYQLKDKLKLSPSASQFVAAVAFFPWSIKPLY 46 >ref|XP_006452278.1| hypothetical protein CICLE_v10008106mg [Citrus clementina] gi|568842416|ref|XP_006475145.1| PREDICTED: probable folate-biopterin transporter 4-like [Citrus sinensis] gi|557555504|gb|ESR65518.1| hypothetical protein CICLE_v10008106mg [Citrus clementina] Length = 493 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKDKLKLSP ASQ + +VAFFPWSI Y Sbjct: 24 GFRSFVWTAVSYQLKDKLKLSPSASQFVAAVAFFPWSIKPLY 65 >gb|EYU33630.1| hypothetical protein MIMGU_mgv1a005060mg [Mimulus guttatus] Length = 498 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKDKL LSP ASQ + SVAFFPWSI Y Sbjct: 28 GFRSFVWTAVSYQLKDKLNLSPAASQFVTSVAFFPWSIKPLY 69 >ref|XP_004251469.1| PREDICTED: probable folate-biopterin transporter 4-like [Solanum lycopersicum] Length = 494 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFYR*NCDSF 52 G RSFVWT +SYQLKD LKLSP ASQ + S+AFFPWSI Y D F Sbjct: 28 GFRSFVWTAVSYQLKDNLKLSPSASQFVTSIAFFPWSIKPLYGILSDCF 76 >ref|XP_006367537.1| PREDICTED: probable folate-biopterin transporter 4-like [Solanum tuberosum] Length = 494 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFYR*NCDSF 52 G RSFVWT +SYQLKD LKLSP ASQ + S+AFFPWS+ Y D F Sbjct: 28 GFRSFVWTAVSYQLKDNLKLSPSASQFVTSIAFFPWSVKPLYGILSDCF 76 >ref|XP_006377846.1| hypothetical protein POPTR_0011s14050g [Populus trichocarpa] gi|550328364|gb|ERP55643.1| hypothetical protein POPTR_0011s14050g [Populus trichocarpa] Length = 432 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 198 GVRSFVWTTISYQLKDKLKLSPLASQLIFSVAFFPWSINLFY 73 G RSFVWT +SYQLKD LKLSP ASQ + S+AFFPWSI Y Sbjct: 42 GFRSFVWTAVSYQLKDNLKLSPSASQFVSSIAFFPWSIKPLY 83