BLASTX nr result
ID: Cocculus23_contig00044167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00044167 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME80952.1| hypothetical protein MYCFIDRAFT_70506 [Pseudocerc... 61 1e-07 gb|EME42057.1| hypothetical protein DOTSEDRAFT_72976 [Dothistrom... 60 3e-07 ref|XP_003851431.1| hypothetical protein MYCGRDRAFT_104795 [Zymo... 59 5e-07 >gb|EME80952.1| hypothetical protein MYCFIDRAFT_70506 [Pseudocercospora fijiensis CIRAD86] Length = 172 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = +2 Query: 2 AYWRRMFLGDYAELFIISPESSPENSQYEGDSRKVSPASTWEYGSQQTDTQLGA 163 AYW R+FLG+Y L+I+SPES+P +S + +SR+ SP STW S + D ++GA Sbjct: 117 AYWSRLFLGNYDHLYIVSPESTPTSSVADSESRRTSPTSTWAQDSTE-DAKIGA 169 >gb|EME42057.1| hypothetical protein DOTSEDRAFT_72976 [Dothistroma septosporum NZE10] Length = 179 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +2 Query: 2 AYWRRMFLGDYAELFIISPESSPENSQYEGDSRKVSPASTWEYGSQQ 142 AYW R+FLG+Y L+I+SPE++P +S + DS++ SP STW GS++ Sbjct: 120 AYWSRLFLGNYDNLYIVSPETTPTSSVADEDSQRTSPTSTWGQGSEE 166 >ref|XP_003851431.1| hypothetical protein MYCGRDRAFT_104795 [Zymoseptoria tritici IPO323] gi|339471311|gb|EGP86407.1| hypothetical protein MYCGRDRAFT_104795 [Zymoseptoria tritici IPO323] Length = 173 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/54 (48%), Positives = 37/54 (68%) Frame = +2 Query: 2 AYWRRMFLGDYAELFIISPESSPENSQYEGDSRKVSPASTWEYGSQQTDTQLGA 163 AYW RM LG+Y +LFI+SPE++P +S + SR+ SP STW S+ + Q+ A Sbjct: 120 AYWSRMILGNYQDLFIVSPETTPTSSVADDGSRRTSPTSTWGQDSEASMRQVAA 173