BLASTX nr result
ID: Cocculus23_contig00043421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00043421 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, part... 47 6e-06 >ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] gi|462421015|gb|EMJ25278.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] Length = 1419 Score = 46.6 bits (109), Expect(2) = 6e-06 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -2 Query: 562 QWRNPHMMISPQWCCLCRRNEGSANHLFLHCPF 464 Q R P++ ISP WC LC + S +HL LHCPF Sbjct: 1319 QRRCPYLCISPHWCALCNKAGESVDHLLLHCPF 1351 Score = 29.3 bits (64), Expect(2) = 6e-06 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 420 WVMPRTCAELITTEI-LCGRSKESQLMWSML 331 WV+P C EL + I GR K+++++W L Sbjct: 1367 WVIPEGCFELFSIRIDALGRGKKAKILWGSL 1397