BLASTX nr result
ID: Cocculus23_contig00043218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00043218 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844422.1| hypothetical protein AMTR_s00016p00026090 [A... 57 2e-06 >ref|XP_006844422.1| hypothetical protein AMTR_s00016p00026090 [Amborella trichopoda] gi|548846893|gb|ERN06097.1| hypothetical protein AMTR_s00016p00026090 [Amborella trichopoda] Length = 1165 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -3 Query: 371 PGSEVLTSTFWLMYFCKHMELQEDLVNSYLPPSVFTLLQ 255 P SEVL S FWLMYFCK+ME+ +DL++S LPPS+ ++L+ Sbjct: 1126 PTSEVLKSAFWLMYFCKYMEVPKDLLDSCLPPSLLSILE 1164