BLASTX nr result
ID: Cocculus23_contig00043182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00043182 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME77362.1| hypothetical protein MYCFIDRAFT_179938 [Pseudocer... 59 7e-07 gb|EMF11211.1| hypothetical protein SEPMUDRAFT_134402 [Sphaeruli... 58 2e-06 >gb|EME77362.1| hypothetical protein MYCFIDRAFT_179938 [Pseudocercospora fijiensis CIRAD86] Length = 228 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 94 IDQATDRAGMGDKYDDKIDKFADKEVNKQIPG 189 +D ATDRAG+GDKYDDKI+KFAD +VNK+IPG Sbjct: 48 VDSATDRAGLGDKYDDKINKFADGQVNKRIPG 79 >gb|EMF11211.1| hypothetical protein SEPMUDRAFT_134402 [Sphaerulina musiva SO2202] Length = 2189 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +1 Query: 61 EGYADKGVNQGIDQATDRAGMGDKYDDKIDKFADKEVNKQIPGG 192 +G + G Q ID ATDR GMGDKYDDKI+K AD ++NK +PGG Sbjct: 2144 KGISGAGHTQ-IDNATDRLGMGDKYDDKINKLADGQINKNVPGG 2186