BLASTX nr result
ID: Cocculus23_contig00043082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00043082 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007217221.1| hypothetical protein PRUPE_ppa003465mg [Prun... 55 2e-06 >ref|XP_007217221.1| hypothetical protein PRUPE_ppa003465mg [Prunus persica] gi|377684868|gb|AFB74453.1| transport inhibitor response protein [Prunus persica] gi|462413371|gb|EMJ18420.1| hypothetical protein PRUPE_ppa003465mg [Prunus persica] Length = 572 Score = 55.5 bits (132), Expect(2) = 2e-06 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 4/50 (8%) Frame = -1 Query: 495 LKPWSSTAKDS----EELRLKRMVVSNESLELLSCPFLDFKSLFLFTYEG 358 L+PW DS EELRLKRMVVS+ESLELLS FL+FKSL L + EG Sbjct: 88 LQPWVEALVDSRVGLEELRLKRMVVSDESLELLSRSFLNFKSLVLVSCEG 137 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 350 FTTTSLTSKVANCRLGRE 297 FTT L + ANCR +E Sbjct: 138 FTTDGLAAIAANCRFLKE 155