BLASTX nr result
ID: Cocculus23_contig00042979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042979 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72727.1| hypothetical protein VITISV_015094 [Vitis vinifera] 41 3e-06 >emb|CAN72727.1| hypothetical protein VITISV_015094 [Vitis vinifera] Length = 1677 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +1 Query: 121 DSQ*WKLDPLTITHANLFILSL*MILT-FQFTPKNFTWEARMPHKVKNFTWLAALNRLNT 297 DS+ W L + F L+L + F P F W +++P KVK WL A ++NT Sbjct: 1470 DSRAWSLSSSGLFSVKSFFLALSKVSNPLMFLPAKFLWSSKVPSKVKALAWLVAHGKVNT 1529 Query: 298 CESTQ 312 + Q Sbjct: 1530 NDKLQ 1534 Score = 35.4 bits (80), Expect(2) = 3e-06 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 324 SMSPSWCILCGRDMESSEHIF 386 ++ P WCILC R+ ESS+HIF Sbjct: 1541 ALCPQWCILCKRNGESSDHIF 1561