BLASTX nr result
ID: Cocculus23_contig00042906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042906 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001799354.1| hypothetical protein SNOG_09051 [Phaeosphaer... 96 7e-18 gb|EMD67804.1| hypothetical protein COCSADRAFT_24141 [Bipolaris ... 95 1e-17 gb|EUC42691.1| hypothetical protein COCMIDRAFT_28713 [Bipolaris ... 94 2e-17 gb|EMD92047.1| hypothetical protein COCHEDRAFT_1193634 [Bipolari... 94 2e-17 gb|EUN21192.1| hypothetical protein COCVIDRAFT_114611 [Bipolaris... 94 3e-17 gb|EUC33868.1| hypothetical protein COCCADRAFT_36325 [Bipolaris ... 94 3e-17 ref|XP_003844496.1| hypothetical protein LEMA_P021470.1 [Leptosp... 93 4e-17 ref|XP_003302111.1| hypothetical protein PTT_13810 [Pyrenophora ... 92 6e-17 ref|XP_001931554.1| conserved hypothetical protein [Pyrenophora ... 89 5e-16 gb|EOA89445.1| hypothetical protein SETTUDRAFT_167911, partial [... 83 5e-14 gb|EKG12349.1| hypothetical protein MPH_10466 [Macrophomina phas... 75 1e-11 emb|CCF46311.1| hypothetical protein CH063_00602 [Colletotrichum... 74 2e-11 ref|XP_001589768.1| predicted protein [Sclerotinia sclerotiorum ... 72 1e-10 gb|EFQ35154.1| hypothetical protein GLRG_10298 [Colletotrichum g... 70 2e-10 gb|EQB56977.1| hypothetical protein CGLO_02952 [Colletotrichum g... 70 4e-10 gb|EON66633.1| hypothetical protein W97_05879 [Coniosporium apol... 70 4e-10 ref|XP_007594899.1| hypothetical protein CFIO01_07718 [Colletotr... 69 5e-10 gb|EMR83873.1| hypothetical protein BcDW1_7505 [Botryotinia fuck... 69 5e-10 ref|XP_001556308.1| predicted protein [Botryotinia fuckeliana B0... 69 9e-10 gb|ENH81353.1| hypothetical protein Cob_00896 [Colletotrichum or... 68 1e-09 >ref|XP_001799354.1| hypothetical protein SNOG_09051 [Phaeosphaeria nodorum SN15] gi|111062123|gb|EAT83243.1| hypothetical protein SNOG_09051 [Phaeosphaeria nodorum SN15] Length = 146 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADKIGANK TNAIPQENPSI+SSAGAIGKQFNPDG +GQIG+ +GGPFSK Sbjct: 60 AADKIGANKGTNAIPQENPSILSSAGAIGKQFNPDGAIGQIGEKVGGPFSK 110 >gb|EMD67804.1| hypothetical protein COCSADRAFT_24141 [Bipolaris sorokiniana ND90Pr] Length = 124 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADK+GANKSTNAIPQ+NPS++SSAGAIGK FNPDG VG IGQAIGGPFSK Sbjct: 40 AADKLGANKSTNAIPQDNPSVLSSAGAIGKNFNPDGAVGSIGQAIGGPFSK 90 >gb|EUC42691.1| hypothetical protein COCMIDRAFT_28713 [Bipolaris oryzae ATCC 44560] Length = 124 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADK+GANKSTNAIPQ+NPS++SSAGAIGK FNPDG +G IGQAIGGPFSK Sbjct: 40 AADKLGANKSTNAIPQDNPSVLSSAGAIGKNFNPDGAIGAIGQAIGGPFSK 90 >gb|EMD92047.1| hypothetical protein COCHEDRAFT_1193634 [Bipolaris maydis C5] gi|477585380|gb|ENI02468.1| hypothetical protein COCC4DRAFT_174436 [Bipolaris maydis ATCC 48331] Length = 124 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADK+GANKSTNAIPQ+NPS++SSAGAIGK FNPDG VG IGQAIGGPFSK Sbjct: 40 AADKLGANKSTNAIPQDNPSMLSSAGAIGKNFNPDGAVGSIGQAIGGPFSK 90 >gb|EUN21192.1| hypothetical protein COCVIDRAFT_114611 [Bipolaris victoriae FI3] Length = 123 Score = 93.6 bits (231), Expect = 3e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADK+GANKSTNAIPQ+NPS++SSAGAIGK FNPDG VG IGQAIGGPFSK Sbjct: 39 AADKLGANKSTNAIPQDNPSMLSSAGAIGKNFNPDGAVGAIGQAIGGPFSK 89 >gb|EUC33868.1| hypothetical protein COCCADRAFT_36325 [Bipolaris zeicola 26-R-13] Length = 123 Score = 93.6 bits (231), Expect = 3e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADK+GANKSTNAIPQ+NPS++SSAGAIGK FNPDG VG IGQAIGGPFSK Sbjct: 39 AADKLGANKSTNAIPQDNPSMLSSAGAIGKNFNPDGAVGAIGQAIGGPFSK 89 >ref|XP_003844496.1| hypothetical protein LEMA_P021470.1 [Leptosphaeria maculans JN3] gi|312221076|emb|CBY01017.1| hypothetical protein LEMA_P021470.1 [Leptosphaeria maculans JN3] Length = 114 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADKIGA K TNAIPQENPS++SSAGAIG+QFNPDG++GQI QA+GGPFSK Sbjct: 30 AADKIGAKKDTNAIPQENPSVLSSAGAIGRQFNPDGSIGQIPQAVGGPFSK 80 >ref|XP_003302111.1| hypothetical protein PTT_13810 [Pyrenophora teres f. teres 0-1] gi|311322692|gb|EFQ89772.1| hypothetical protein PTT_13810 [Pyrenophora teres f. teres 0-1] Length = 92 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADKIGANK TNAIP+ENPSIISSAG IGKQFNPDG++GQIG+ IGGP SK Sbjct: 8 AADKIGANKDTNAIPKENPSIISSAGVIGKQFNPDGSIGQIGEKIGGPLSK 58 >ref|XP_001931554.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973160|gb|EDU40659.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 122 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AADKIGANK TNAIP+ENPS+ISS GAIGKQFNP+G +GQIG+ IGGP SK Sbjct: 38 AADKIGANKDTNAIPKENPSVISSEGAIGKQFNPNGTIGQIGEKIGGPLSK 88 >gb|EOA89445.1| hypothetical protein SETTUDRAFT_167911, partial [Setosphaeria turcica Et28A] Length = 127 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 74 ADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFS 220 AD +GANK+TNAIPQENPS++SSAG IGK FNPDG +GQ G +IGGPF+ Sbjct: 44 ADTLGANKTTNAIPQENPSVLSSAGVIGKNFNPDGAIGQAGSSIGGPFA 92 >gb|EKG12349.1| hypothetical protein MPH_10466 [Macrophomina phaseolina MS6] Length = 90 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AA+ GANK+TN NPS+ISS GAIGKQFNP+GN+GQIG+ +GGPFSK Sbjct: 10 AAESAGANKATNPA---NPSVISSEGAIGKQFNPEGNIGQIGEKVGGPFSK 57 >emb|CCF46311.1| hypothetical protein CH063_00602 [Colletotrichum higginsianum] Length = 110 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AAD +G K TN PS+ISS GA+GKQFNPDGNVGQIG+A+GGPFSK Sbjct: 31 AADAVGQEKDTNPA---KPSVISSEGAVGKQFNPDGNVGQIGEAVGGPFSK 78 >ref|XP_001589768.1| predicted protein [Sclerotinia sclerotiorum 1980] gi|154693885|gb|EDN93623.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 90 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AA G K TN NPS+ISS GAIGKQFNPDGN+GQIG+ IGGPFSK Sbjct: 9 AAQAAGEKKDTNP---SNPSVISSGGAIGKQFNPDGNIGQIGEKIGGPFSK 56 >gb|EFQ35154.1| hypothetical protein GLRG_10298 [Colletotrichum graminicola M1.001] Length = 89 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AA G K T+ NPS+ISS GAIGKQFNPDGN+GQIG+A+GGPFSK Sbjct: 10 AAKTAGQKKDTSP---SNPSVISSEGAIGKQFNPDGNIGQIGEAVGGPFSK 57 >gb|EQB56977.1| hypothetical protein CGLO_02952 [Colletotrichum gloeosporioides Cg-14] Length = 89 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AA G K T+ NPSIISS GAIGKQFNPDGN+GQIG+ IGGPFSK Sbjct: 10 AASAAGEKKDTSP---SNPSIISSEGAIGKQFNPDGNIGQIGEKIGGPFSK 57 >gb|EON66633.1| hypothetical protein W97_05879 [Coniosporium apollinis CBS 100218] Length = 93 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/50 (64%), Positives = 42/50 (84%) Frame = +2 Query: 74 ADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 A++ GA K ++ +NPS+ISS GA+GKQFNPDG++GQIG+AIGGPFSK Sbjct: 11 AEQAGAAKQSS--DPQNPSVISSGGAVGKQFNPDGSIGQIGEAIGGPFSK 58 >ref|XP_007594899.1| hypothetical protein CFIO01_07718 [Colletotrichum fioriniae PJ7] gi|588900931|gb|EXF81475.1| hypothetical protein CFIO01_07718 [Colletotrichum fioriniae PJ7] Length = 110 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 AA+ G K T+ PS+ISS GAIGKQFNPDGN+GQIG+A+GGPFSK Sbjct: 31 AAEAAGQKKDTSP---SKPSVISSEGAIGKQFNPDGNIGQIGEAVGGPFSK 78 >gb|EMR83873.1| hypothetical protein BcDW1_7505 [Botryotinia fuckeliana BcDW1] Length = 119 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 A+ G K T+ NPS+ISSAGA+GKQFNPDGN+GQIG+ IGGPFSK Sbjct: 37 ASQVAGEKKDTSP---SNPSVISSAGAVGKQFNPDGNIGQIGEKIGGPFSK 84 >ref|XP_001556308.1| predicted protein [Botryotinia fuckeliana B05.10] gi|347831368|emb|CCD47065.1| hypothetical protein BofuT4_P039670.1 [Botryotinia fuckeliana T4] Length = 119 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +2 Query: 71 AADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 A+ G K T+ NPS+ISSAGA+GKQFNPDGN+GQ+G+ IGGPFSK Sbjct: 37 ASQVAGEKKDTSP---SNPSVISSAGAVGKQFNPDGNIGQLGEKIGGPFSK 84 >gb|ENH81353.1| hypothetical protein Cob_00896 [Colletotrichum orbiculare MAFF 240422] Length = 89 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +2 Query: 74 ADKIGANKSTNAIPQENPSIISSAGAIGKQFNPDGNVGQIGQAIGGPFSK 223 A+ G K T+ NPS+ISS GAIGKQFNPDGN+GQIG+ +GGPFSK Sbjct: 11 AETAGEKKDTSPA---NPSVISSGGAIGKQFNPDGNIGQIGEKVGGPFSK 57