BLASTX nr result
ID: Cocculus23_contig00042816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042816 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006399832.1| hypothetical protein EUTSA_v10014743mg [Eutr... 64 2e-08 ref|XP_004253232.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 3e-08 gb|EYU28483.1| hypothetical protein MIMGU_mgv1a012151mg [Mimulus... 63 5e-08 gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus... 63 5e-08 ref|XP_006657427.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 5e-08 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 63 5e-08 ref|XP_006487562.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 5e-08 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 5e-08 ref|XP_006343509.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 5e-08 ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phas... 63 5e-08 ref|XP_006420813.1| hypothetical protein CICLE_v10005642mg [Citr... 63 5e-08 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 63 5e-08 ref|XP_006420810.1| hypothetical protein CICLE_v10005642mg [Citr... 63 5e-08 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 63 5e-08 ref|XP_006420807.1| hypothetical protein CICLE_v10005642mg [Citr... 63 5e-08 ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Popu... 63 5e-08 ref|XP_006368849.1| hypothetical protein POPTR_0001s12920g [Popu... 63 5e-08 ref|XP_006844451.1| hypothetical protein AMTR_s00016p00074550 [A... 63 5e-08 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 5e-08 ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 5e-08 >ref|XP_006399832.1| hypothetical protein EUTSA_v10014743mg [Eutrema salsugineum] gi|557100922|gb|ESQ41285.1| hypothetical protein EUTSA_v10014743mg [Eutrema salsugineum] Length = 193 Score = 63.9 bits (154), Expect = 2e-08 Identities = 39/85 (45%), Positives = 51/85 (60%), Gaps = 10/85 (11%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFEVCTSSHT*FISFTH--IYLFE--ISSLI----- 154 VDWDGYT+GYYGRIFEARNKTKGGSFE ++ F +H I FE +S + Sbjct: 77 VDWDGYTIGYYGRIFEARNKTKGGSFEGDDKAYFKFTLGSHEVIPAFEEAVSGMALGGVR 136 Query: 155 -HILAPYWFWIRYDFDISWPPPSSF 226 ++ P + D++ S P PS+F Sbjct: 137 RLVVPPELGYPENDYNKSAPRPSTF 161 >ref|XP_004253232.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Solanum lycopersicum] Length = 247 Score = 63.5 bits (153), Expect = 3e-08 Identities = 39/87 (44%), Positives = 47/87 (54%), Gaps = 12/87 (13%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFEVCTSSHT*F------------ISFTHIYLFEIS 145 VDWDGYT+GYYGRIFEARNKTKGGSFE F + T I L I Sbjct: 131 VDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDFFKFRVGSQEVIPAFEEAITGIALGGIR 190 Query: 146 SLIHILAPYWFWIRYDFDISWPPPSSF 226 + I+ P + YD+D P P++F Sbjct: 191 RI--IVPPELGYPNYDYDKKGPRPTTF 215 >gb|EYU28483.1| hypothetical protein MIMGU_mgv1a012151mg [Mimulus guttatus] Length = 260 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 141 VDWDGYTIGYYGRIFEARNKTKGGSFE 167 >gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus notabilis] Length = 350 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 234 VDWDGYTIGYYGRIFEARNKTKGGSFE 260 >ref|XP_006657427.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Oryza brachyantha] Length = 240 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 123 VDWDGYTIGYYGRIFEARNKTKGGSFE 149 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 126 VDWDGYTIGYYGRIFEARNKTKGGSFE 152 >ref|XP_006487562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X2 [Citrus sinensis] Length = 226 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 151 VDWDGYTIGYYGRIFEARNKTKGGSFE 177 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 151 VDWDGYTIGYYGRIFEARNKTKGGSFE 177 >ref|XP_006343509.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Solanum tuberosum] Length = 335 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 219 VDWDGYTIGYYGRIFEARNKTKGGSFE 245 >ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] gi|561012330|gb|ESW11191.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] Length = 274 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 158 VDWDGYTIGYYGRIFEARNKTKGGSFE 184 >ref|XP_006420813.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522686|gb|ESR34053.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 213 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 151 VDWDGYTIGYYGRIFEARNKTKGGSFE 177 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 134 VDWDGYTIGYYGRIFEARNKTKGGSFE 160 >ref|XP_006420810.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522683|gb|ESR34050.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 231 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 151 VDWDGYTIGYYGRIFEARNKTKGGSFE 177 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 151 VDWDGYTIGYYGRIFEARNKTKGGSFE 177 >ref|XP_006420807.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855383|ref|XP_006420811.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522680|gb|ESR34047.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522684|gb|ESR34051.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 217 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 151 VDWDGYTIGYYGRIFEARNKTKGGSFE 177 >ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347126|gb|EEE82687.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 245 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 129 VDWDGYTIGYYGRIFEARNKTKGGSFE 155 >ref|XP_006368849.1| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347125|gb|ERP65418.1| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 178 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 129 VDWDGYTIGYYGRIFEARNKTKGGSFE 155 >ref|XP_006844451.1| hypothetical protein AMTR_s00016p00074550 [Amborella trichopoda] gi|548846922|gb|ERN06126.1| hypothetical protein AMTR_s00016p00074550 [Amborella trichopoda] Length = 188 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 72 VDWDGYTIGYYGRIFEARNKTKGGSFE 98 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Setaria italica] Length = 214 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 97 VDWDGYTIGYYGRIFEARNKTKGGSFE 123 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VDWDGYTVGYYGRIFEARNKTKGGSFE 82 VDWDGYT+GYYGRIFEARNKTKGGSFE Sbjct: 124 VDWDGYTIGYYGRIFEARNKTKGGSFE 150