BLASTX nr result
ID: Cocculus23_contig00042680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042680 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541308.1| PREDICTED: probable zinc transporter protein... 56 4e-06 >ref|XP_003541308.1| PREDICTED: probable zinc transporter protein DDB_G0291141 isoform 1 [Glycine max] Length = 359 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 284 GFGIYEATSLERVRRDSLQPSDIANETFENHIHGSPLPT 168 GFGIYEATSLER R+DS++ SD++N F+N I SPLPT Sbjct: 321 GFGIYEATSLERNRKDSIRNSDLSNGEFDNQIQMSPLPT 359