BLASTX nr result
ID: Cocculus23_contig00042572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00042572 (569 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF14911.1| hypothetical protein SEPMUDRAFT_37969 [Sphaerulin... 59 9e-07 >gb|EMF14911.1| hypothetical protein SEPMUDRAFT_37969 [Sphaerulina musiva SO2202] Length = 606 Score = 58.9 bits (141), Expect = 9e-07 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = +1 Query: 166 ASSITRPSHPSRKHTLSELIDLDNLNPGDLVESPSGDLLSLEAARLRPDRPPSIRERQER 345 ASS + S RK+ L E+ID D + G V SPSG+LL+ + R R DRPP +RERQ+R Sbjct: 20 ASSHSETSPYGRKNMLEEIIDPDEIPVGSHVRSPSGNLLNAQEFRDRSDRPPCMRERQQR 79 Query: 346 IL 351 IL Sbjct: 80 IL 81