BLASTX nr result
ID: Cocculus23_contig00041946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041946 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB89996.1| hypothetical protein L484_023649 [Morus notabilis] 56 6e-06 >gb|EXB89996.1| hypothetical protein L484_023649 [Morus notabilis] Length = 93 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = +3 Query: 81 MFHSAHPYCNIIHITT-ISPDYNFIWYVWCLSLLYRIALAFDSLSIQVHLTNPKKNKSLV 257 M++ PY H+ + + IWY+WCL LYRIAL + + HL+NP S++ Sbjct: 1 MYNPDQPYLATFHLRPFVKVTRDDIWYLWCLMTLYRIALNCPLMQMHTHLSNPGNEGSVL 60 Query: 258 WSMLQWLSP 284 W +L+ ++P Sbjct: 61 WQLLEMINP 69