BLASTX nr result
ID: Cocculus23_contig00041715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041715 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 55 1e-05 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/56 (50%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +2 Query: 41 KRLLPVPPQSISAIPPTSSSCTQNKKYIKV-IDECSFCKQKIHWKDQCPQLLNKIQ 205 K +L S+ A+P S QNK Y +V DECSFCKQK HWK QCP+L + Q Sbjct: 211 KGILSASNPSVLAVPSKPFSNHQNKPYTRVGFDECSFCKQKGHWKAQCPKLRQQNQ 266