BLASTX nr result
ID: Cocculus23_contig00041277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00041277 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 65 2e-17 ref|XP_002518611.1| conserved hypothetical protein [Ricinus comm... 57 1e-12 emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 64 2e-09 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 65.5 bits (158), Expect(2) = 2e-17 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 65 PLIFFSIGASSNATRFYLTKPRARPRREFALPNSPF**QGRKPRP 199 P FSIGASS+ATRFYLTKPRARPRREFALPNS F + P P Sbjct: 147 PTDLFSIGASSSATRFYLTKPRARPRREFALPNSLFDNKAETPDP 191 Score = 48.9 bits (115), Expect(2) = 2e-17 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +1 Query: 1 FFGVVGEGLPFLTHILSYRHGPTYFF 78 FFGVVGEGL FLTHI SYRHGPT F Sbjct: 126 FFGVVGEGLTFLTHIHSYRHGPTDLF 151 >ref|XP_002518611.1| conserved hypothetical protein [Ricinus communis] gi|223542210|gb|EEF43753.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 57.4 bits (137), Expect(3) = 1e-12 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +2 Query: 62 APLIFFSIGASSNATRFYLTKPRARPRREFALPNSPF 172 +P FSIGASS+ T+FYLTKP A PRREFALPNS F Sbjct: 9 SPTDLFSIGASSSTTQFYLTKPHAHPRREFALPNSLF 45 Score = 37.4 bits (85), Expect(3) = 1e-12 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 159 PTPLFDNKAESPDPTFISFE 218 P LFDNKAE+PD TFISFE Sbjct: 41 PNSLFDNKAETPDQTFISFE 60 Score = 23.5 bits (49), Expect(3) = 1e-12 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 40 HILSYRHGPTYFF 78 HI SYRH PT F Sbjct: 2 HIQSYRHSPTDLF 14 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 63.9 bits (154), Expect(2) = 2e-09 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = +2 Query: 65 PLIFFSIGASSNATRFYLTKPRARPRREFALPNSPF**QGRKPRP 199 P FSIGASS+ATRFYLTKPRARPRREFALPN F + P P Sbjct: 74 PTDLFSIGASSSATRFYLTKPRARPRREFALPNPLFDNKAESPDP 118 Score = 23.5 bits (49), Expect(2) = 2e-09 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 46 LSYRHGPTYFF 78 LSYRHGPT F Sbjct: 68 LSYRHGPTDLF 78