BLASTX nr result
ID: Cocculus23_contig00040918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040918 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310774.2| hypothetical protein POPTR_0007s12170g [Popu... 58 1e-06 ref|XP_002306443.2| hypothetical protein POPTR_0005s13780g [Popu... 56 5e-06 ref|XP_002522396.1| bel1 homeotic protein, putative [Ricinus com... 55 8e-06 >ref|XP_002310774.2| hypothetical protein POPTR_0007s12170g [Populus trichocarpa] gi|566180906|ref|XP_006380743.1| hypothetical protein POPTR_0007s12170g [Populus trichocarpa] gi|550334712|gb|EEE91224.2| hypothetical protein POPTR_0007s12170g [Populus trichocarpa] gi|550334713|gb|ERP58540.1| hypothetical protein POPTR_0007s12170g [Populus trichocarpa] Length = 824 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 332 STLVNFRTTTTGDVSLTLGLRHAGNLQPEKNRFSVVRDFGDC 207 STL+ F TTT GDVSLTLGLRHAGN+ PEK+ +RDFG C Sbjct: 784 STLIRFGTTTAGDVSLTLGLRHAGNM-PEKSPTFSMRDFGGC 824 >ref|XP_002306443.2| hypothetical protein POPTR_0005s13780g [Populus trichocarpa] gi|550338869|gb|EEE93439.2| hypothetical protein POPTR_0005s13780g [Populus trichocarpa] Length = 825 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 332 STLVNFRTTTTGDVSLTLGLRHAGNLQPEKNRFSVVRDFGDC 207 STL+ F T+T GDVSLTLGLRHAGN+ P+K+ VRDFG C Sbjct: 785 STLIRFGTSTAGDVSLTLGLRHAGNV-PDKSPTFSVRDFGGC 825 >ref|XP_002522396.1| bel1 homeotic protein, putative [Ricinus communis] gi|223538474|gb|EEF40080.1| bel1 homeotic protein, putative [Ricinus communis] Length = 562 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/46 (69%), Positives = 35/46 (76%), Gaps = 4/46 (8%) Frame = -3 Query: 332 STLVNFRTTTT--GDVSLTLGLRHAGNLQPEKNRFSV--VRDFGDC 207 STL+ F TTT GDVSLTLGLRHAGN+ PEKN S VRDFG+C Sbjct: 518 STLIRFGTTTAAAGDVSLTLGLRHAGNM-PEKNTASAFSVRDFGNC 562