BLASTX nr result
ID: Cocculus23_contig00040187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00040187 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003855530.1| hypothetical protein MYCGRDRAFT_68429 [Zymos... 69 7e-10 gb|EMF11064.1| kinase-like protein [Sphaerulina musiva SO2202] 60 3e-07 >ref|XP_003855530.1| hypothetical protein MYCGRDRAFT_68429 [Zymoseptoria tritici IPO323] gi|339475414|gb|EGP90506.1| hypothetical protein MYCGRDRAFT_68429 [Zymoseptoria tritici IPO323] Length = 419 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 5/63 (7%) Frame = +3 Query: 3 PPSSGPCTPQPTQ-----HTFAPKPAVVPTGVCSPFYGHMPDFRRCGQMLSHFNVPSQFW 167 PPSSGPCTPQPT H P V P+ SPF+ ++PDFRRCG +LS F P W Sbjct: 359 PPSSGPCTPQPTNLYTSTHHQQKPPVVYPS---SPFFANLPDFRRCGHLLSSFQFPQHAW 415 Query: 168 AVT 176 A T Sbjct: 416 AAT 418 >gb|EMF11064.1| kinase-like protein [Sphaerulina musiva SO2202] Length = 420 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +3 Query: 3 PPSSGPCTPQPTQHTFAPKPAVVPTGVCSPFYGHMPDFRRCGQMLSHFNVPSQFWAVT 176 PP++GPC+PQ T PK +V P+ PF+G+ F RCGQM ++FN+P+ WA T Sbjct: 363 PPATGPCSPQTTHCAPQPK-SVGPSMYPGPFFGNFATFGRCGQMFANFNMPTHAWAST 419