BLASTX nr result
ID: Cocculus23_contig00039804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00039804 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632414.1| PREDICTED: uncharacterized protein LOC100855... 59 9e-07 emb|CAN64022.1| hypothetical protein VITISV_005264 [Vitis vinifera] 59 9e-07 >ref|XP_003632414.1| PREDICTED: uncharacterized protein LOC100855416 [Vitis vinifera] Length = 147 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +3 Query: 45 LMEETQQFEKGTLVEVSSDDAGLRGAWFIATVLR-TNSRTKKVFVEYQSLMANE 203 ++ E + +KG VEVSS++ GLRG+W+ ATVLR +TKK++VEY +LM+ E Sbjct: 1 MVTEAEGLKKGEKVEVSSEEEGLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEE 54 >emb|CAN64022.1| hypothetical protein VITISV_005264 [Vitis vinifera] Length = 1348 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +3 Query: 45 LMEETQQFEKGTLVEVSSDDAGLRGAWFIATVLR-TNSRTKKVFVEYQSLMANE 203 ++ E + +KG VEVSS++ GLRG+W+ ATVLR +TKK++VEY +LM+ E Sbjct: 1202 MVTEAEGLKKGEKVEVSSEEEGLRGSWYTATVLRPVTKKTKKIYVEYHTLMSEE 1255