BLASTX nr result
ID: Cocculus23_contig00039724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00039724 (587 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS83704.1| hypothetical protein PFICI_05580 [Pestalotiopsis ... 94 3e-17 >gb|ETS83704.1| hypothetical protein PFICI_05580 [Pestalotiopsis fici W106-1] Length = 637 Score = 94.0 bits (232), Expect = 3e-17 Identities = 43/63 (68%), Positives = 52/63 (82%) Frame = -3 Query: 585 SNVRIVDGSIFPYQPSAHPMGLTYAVAVRAARLFQQQSGGGGLTFTEQLPASNSSANATA 406 +NVR+VDGS+FPYQPSAHPMG+TYA+AVRAA + QQ GGGGLT T +LP N+S A A Sbjct: 570 TNVRVVDGSVFPYQPSAHPMGVTYALAVRAASILQQLEGGGGLTETTRLPVKNASMAAVA 629 Query: 405 IFP 397 +FP Sbjct: 630 MFP 632