BLASTX nr result
ID: Cocculus23_contig00038936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00038936 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36618.1| hypothetical protein MIMGU_mgv1a003262mg [Mimulus... 59 9e-07 gb|EPS72282.1| methylenetetrahydrofolate reductase [Genlisea aurea] 58 2e-06 ref|XP_004981294.1| PREDICTED: methylenetetrahydrofolate reducta... 58 2e-06 gb|EXB59936.1| Methylenetetrahydrofolate reductase 2 [Morus nota... 57 4e-06 ref|XP_006650787.1| PREDICTED: probable methylenetetrahydrofolat... 57 4e-06 ref|XP_006478513.1| PREDICTED: methylenetetrahydrofolate reducta... 57 4e-06 ref|XP_007145947.1| hypothetical protein PHAVU_007G281200g [Phas... 57 4e-06 ref|XP_007145946.1| hypothetical protein PHAVU_007G281200g [Phas... 57 4e-06 ref|XP_007145945.1| hypothetical protein PHAVU_007G281200g [Phas... 57 4e-06 ref|XP_006441969.1| hypothetical protein CICLE_v10019406mg [Citr... 57 4e-06 ref|XP_006441968.1| hypothetical protein CICLE_v10019406mg [Citr... 57 4e-06 ref|XP_007034229.1| Methylenetetrahydrofolate reductase isoform ... 57 4e-06 ref|XP_007034228.1| Methylenetetrahydrofolate reductase isoform ... 57 4e-06 ref|XP_007034227.1| Methylenetetrahydrofolate reductase isoform ... 57 4e-06 ref|XP_007034226.1| Methylenetetrahydrofolate reductase isoform ... 57 4e-06 ref|XP_004138970.1| PREDICTED: methylenetetrahydrofolate reducta... 57 4e-06 ref|NP_001051683.1| Os03g0815200 [Oryza sativa Japonica Group] g... 57 4e-06 ref|NP_001104947.1| methylenetetrahydrofolate reductase 1 [Zea m... 57 4e-06 gb|AEL33269.1| methylenetetrahydrofolate reductase [Nicotiana sy... 57 4e-06 gb|AEL33267.1| methylenetetrahydrofolate reductase [Nicotiana ta... 57 4e-06 >gb|EYU36618.1| hypothetical protein MIMGU_mgv1a003262mg [Mimulus guttatus] Length = 595 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 VDDCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VDDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >gb|EPS72282.1| methylenetetrahydrofolate reductase [Genlisea aurea] Length = 552 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 VDDCRQ+GITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VDDCRQLGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_004981294.1| PREDICTED: methylenetetrahydrofolate reductase 1-like [Setaria italica] Length = 595 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 VDDCRQIGITCPIVPGI PI +YK F+R+T G C + Sbjct: 205 VDDCRQIGITCPIVPGIMPINNYKGFIRMT-GFCKTKI 241 >gb|EXB59936.1| Methylenetetrahydrofolate reductase 2 [Morus notabilis] Length = 595 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQ+GITCPIVPGI PI +YK FLR+T G C V Sbjct: 206 VNDCRQVGITCPIVPGIMPINNYKGFLRMT-GFCKTKV 242 >ref|XP_006650787.1| PREDICTED: probable methylenetetrahydrofolate reductase-like [Oryza brachyantha] Length = 594 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 205 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 241 >ref|XP_006478513.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Citrus sinensis] Length = 594 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 205 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 241 >ref|XP_007145947.1| hypothetical protein PHAVU_007G281200g [Phaseolus vulgaris] gi|561019137|gb|ESW17941.1| hypothetical protein PHAVU_007G281200g [Phaseolus vulgaris] Length = 577 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_007145946.1| hypothetical protein PHAVU_007G281200g [Phaseolus vulgaris] gi|561019136|gb|ESW17940.1| hypothetical protein PHAVU_007G281200g [Phaseolus vulgaris] Length = 553 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_007145945.1| hypothetical protein PHAVU_007G281200g [Phaseolus vulgaris] gi|561019135|gb|ESW17939.1| hypothetical protein PHAVU_007G281200g [Phaseolus vulgaris] Length = 595 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_006441969.1| hypothetical protein CICLE_v10019406mg [Citrus clementina] gi|557544231|gb|ESR55209.1| hypothetical protein CICLE_v10019406mg [Citrus clementina] Length = 594 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 205 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 241 >ref|XP_006441968.1| hypothetical protein CICLE_v10019406mg [Citrus clementina] gi|557544230|gb|ESR55208.1| hypothetical protein CICLE_v10019406mg [Citrus clementina] Length = 572 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 205 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 241 >ref|XP_007034229.1| Methylenetetrahydrofolate reductase isoform 4 [Theobroma cacao] gi|508713258|gb|EOY05155.1| Methylenetetrahydrofolate reductase isoform 4 [Theobroma cacao] Length = 401 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_007034228.1| Methylenetetrahydrofolate reductase isoform 3 [Theobroma cacao] gi|508713257|gb|EOY05154.1| Methylenetetrahydrofolate reductase isoform 3 [Theobroma cacao] Length = 406 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_007034227.1| Methylenetetrahydrofolate reductase isoform 2, partial [Theobroma cacao] gi|508713256|gb|EOY05153.1| Methylenetetrahydrofolate reductase isoform 2, partial [Theobroma cacao] Length = 478 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_007034226.1| Methylenetetrahydrofolate reductase isoform 1 [Theobroma cacao] gi|508713255|gb|EOY05152.1| Methylenetetrahydrofolate reductase isoform 1 [Theobroma cacao] Length = 599 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >ref|XP_004138970.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Cucumis sativus] gi|449523165|ref|XP_004168595.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Cucumis sativus] Length = 596 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 207 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 243 >ref|NP_001051683.1| Os03g0815200 [Oryza sativa Japonica Group] gi|75294984|sp|Q75HE6.1|MTHR_ORYSJ RecName: Full=Probable methylenetetrahydrofolate reductase gi|40786561|gb|AAR89836.1| putative methylenetetrahydrofolate reductase [Oryza sativa Japonica Group] gi|108711742|gb|ABF99537.1| Methylenetetrahydrofolate reductase, putative, expressed [Oryza sativa Japonica Group] gi|113550154|dbj|BAF13597.1| Os03g0815200 [Oryza sativa Japonica Group] gi|125546191|gb|EAY92330.1| hypothetical protein OsI_14054 [Oryza sativa Indica Group] gi|125588378|gb|EAZ29042.1| hypothetical protein OsJ_13093 [Oryza sativa Japonica Group] gi|530684256|gb|AGT38455.1| methylenetetrahydrofolate reductase [Oryza sativa Japonica Group] Length = 594 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 205 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 241 >ref|NP_001104947.1| methylenetetrahydrofolate reductase 1 [Zea mays] gi|75313356|sp|Q9SE94.1|MTHR1_MAIZE RecName: Full=Methylenetetrahydrofolate reductase 1; AltName: Full=ZmMTHFR1 gi|5802606|gb|AAD51733.1|AF174486_1 methylenetetrahydrofolate reductase [Zea mays] gi|414873582|tpg|DAA52139.1| TPA: methylenetetrahydrofolate reductase 1 [Zea mays] Length = 593 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 205 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 241 >gb|AEL33269.1| methylenetetrahydrofolate reductase [Nicotiana sylvestris] Length = 595 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242 >gb|AEL33267.1| methylenetetrahydrofolate reductase [Nicotiana tabacum] Length = 595 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 268 VDDCRQIGITCPIVPGITPICHYKAFLRLTAGACNPSV 155 V+DCRQIGITCPIVPGI PI +YK FLR+T G C + Sbjct: 206 VNDCRQIGITCPIVPGIMPINNYKGFLRMT-GFCKTKI 242