BLASTX nr result
ID: Cocculus23_contig00038773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00038773 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containi... 53 3e-11 >ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 624 Score = 53.1 bits (126), Expect(2) = 3e-11 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 157 IPTTGLLKLLAFSRFASLSYAHLVFDKIPSPDLFIYNTM 273 I LLK+L S F SLSYAH +FD+IP PD+FIYNTM Sbjct: 48 ITANKLLKVLIASSFGSLSYAHQLFDQIPKPDVFIYNTM 86 Score = 40.4 bits (93), Expect(2) = 3e-11 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = +2 Query: 35 MKRCYSTYLTAIKPKRPLNSNSQLLTLIDSCNSIAQMKQAQS 160 MKRCYST+ K+PLNSN L ++SC S+ Q+KQ + Sbjct: 1 MKRCYSTF------KKPLNSNQLQLFSLESCKSMNQIKQTHA 36