BLASTX nr result
ID: Cocculus23_contig00038570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00038570 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856736.1| hypothetical protein AMTR_s00054p00223760, p... 56 4e-06 >ref|XP_006856736.1| hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] gi|548860636|gb|ERN18203.1| hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] Length = 67 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 139 IEHYSKYSKVENCCSLEHRSVEVVPTISIRVW 234 I+HYS++SK ENCCSLE RS +VVPTI +RVW Sbjct: 35 IDHYSQFSKAENCCSLECRSAKVVPTIDVRVW 66