BLASTX nr result
ID: Cocculus23_contig00037980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037980 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28882.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002276594.1| PREDICTED: centromere/kinetochore protein zw... 70 4e-10 ref|XP_004240154.1| PREDICTED: centromere/kinetochore protein zw... 64 3e-08 ref|XP_006342259.1| PREDICTED: centromere/kinetochore protein zw... 62 1e-07 ref|XP_004165751.1| PREDICTED: centromere/kinetochore protein zw... 60 3e-07 ref|XP_004143232.1| PREDICTED: centromere/kinetochore protein zw... 60 3e-07 ref|XP_006829514.1| hypothetical protein AMTR_s00074p00135900 [A... 57 3e-06 ref|XP_007216475.1| hypothetical protein PRUPE_ppa025961mg [Prun... 57 3e-06 ref|XP_004491085.1| PREDICTED: centromere/kinetochore protein zw... 56 6e-06 ref|XP_006575570.1| PREDICTED: centromere/kinetochore protein zw... 55 8e-06 >emb|CBI28882.3| unnamed protein product [Vitis vinifera] Length = 702 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEESSPLSAPDLRLLIDRLQVRSLQIK 238 MDVLF SI+VR+LLS+ + +ESSPLSAPDLRLLIDRLQ +SLQIK Sbjct: 1 MDVLFNSINVRDLLSSHDLDESSPLSAPDLRLLIDRLQFQSLQIK 45 >ref|XP_002276594.1| PREDICTED: centromere/kinetochore protein zw10 homolog [Vitis vinifera] Length = 744 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEESSPLSAPDLRLLIDRLQVRSLQIK 238 MDVLF SI+VR+LLS+ + +ESSPLSAPDLRLLIDRLQ +SLQIK Sbjct: 1 MDVLFNSINVRDLLSSHDLDESSPLSAPDLRLLIDRLQFQSLQIK 45 >ref|XP_004240154.1| PREDICTED: centromere/kinetochore protein zw10 homolog [Solanum lycopersicum] Length = 764 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/46 (71%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE-SSPLSAPDLRLLIDRLQVRSLQIK 238 MDVLF SIDVR+LLS+ + ++ +SPLSAPDLRLLIDRLQ+RS+ IK Sbjct: 1 MDVLFNSIDVRDLLSSPDIDDVNSPLSAPDLRLLIDRLQLRSVDIK 46 >ref|XP_006342259.1| PREDICTED: centromere/kinetochore protein zw10 homolog isoform X1 [Solanum tuberosum] Length = 764 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/46 (69%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE-SSPLSAPDLRLLIDRLQVRSLQIK 238 MDVLF SI+VR+LLS+ + ++ +SPLSAPDLRLLIDRLQ+RS+ IK Sbjct: 1 MDVLFNSINVRDLLSSPDIDDVNSPLSAPDLRLLIDRLQLRSVDIK 46 >ref|XP_004165751.1| PREDICTED: centromere/kinetochore protein zw10 homolog [Cucumis sativus] Length = 760 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/46 (65%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE-SSPLSAPDLRLLIDRLQVRSLQIK 238 M+ LFGSID+RELLS Q+ + ++PLSAPDLRLL++RL+ SLQIK Sbjct: 1 MEALFGSIDIRELLSAQDISDPTAPLSAPDLRLLVNRLESHSLQIK 46 >ref|XP_004143232.1| PREDICTED: centromere/kinetochore protein zw10 homolog [Cucumis sativus] Length = 760 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/46 (65%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE-SSPLSAPDLRLLIDRLQVRSLQIK 238 M+ LFGSID+RELLS Q+ + ++PLSAPDLRLL++RL+ SLQIK Sbjct: 1 MEALFGSIDIRELLSAQDISDPTAPLSAPDLRLLVNRLESHSLQIK 46 >ref|XP_006829514.1| hypothetical protein AMTR_s00074p00135900 [Amborella trichopoda] gi|548834998|gb|ERM96930.1| hypothetical protein AMTR_s00074p00135900 [Amborella trichopoda] Length = 858 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE--SSPLSAPDLRLLIDRLQVRSLQIK 238 MDVLFGSID+R+LL + + SPLSAPDLRLLID L RSL IK Sbjct: 1 MDVLFGSIDIRDLLPNHDDVDLQESPLSAPDLRLLIDTLNTRSLHIK 47 >ref|XP_007216475.1| hypothetical protein PRUPE_ppa025961mg [Prunus persica] gi|462412625|gb|EMJ17674.1| hypothetical protein PRUPE_ppa025961mg [Prunus persica] Length = 756 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE-SSPLSAPDLRLLIDRLQVRSLQIK 238 MD LF SI+VRELLS Q+ + ++PLSAPDLRLLI RL SLQIK Sbjct: 1 MDALFDSINVRELLSAQDLSDPTTPLSAPDLRLLIQRLDSHSLQIK 46 >ref|XP_004491085.1| PREDICTED: centromere/kinetochore protein zw10 homolog [Cicer arietinum] Length = 752 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/46 (63%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNF-EESSPLSAPDLRLLIDRLQVRSLQIK 238 M+ LF SI+VR+LLS Q+ +++SPLSAPDLRLLIDR++ SLQI+ Sbjct: 1 MESLFDSINVRDLLSAQDLSDQNSPLSAPDLRLLIDRVESHSLQIR 46 >ref|XP_006575570.1| PREDICTED: centromere/kinetochore protein zw10 homolog isoform X1 [Glycine max] Length = 752 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/46 (63%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +2 Query: 104 MDVLFGSIDVRELLSTQNFEE-SSPLSAPDLRLLIDRLQVRSLQIK 238 M+ LFGSI+VR+LLS Q+ + +SPLSAPDLRLLI RL+ +S QI+ Sbjct: 1 MESLFGSINVRDLLSAQDLSDPNSPLSAPDLRLLIQRLESQSFQIR 46