BLASTX nr result
ID: Cocculus23_contig00037942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037942 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 72 9e-20 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 92 6e-17 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 57 3e-06 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 71.6 bits (174), Expect(2) = 9e-20 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 245 GGGITPFSKEPYVTLSRHTAPSRNQDPSFPLTNGSS 138 GGGITPFSKEPYVTLSRHTAPSRN+D FPLTNGSS Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSS 55 Score = 50.8 bits (120), Expect(2) = 9e-20 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 118 PFHSFID*FKVALACFQVQALAVEASRQKRTSGPGR 11 PF+S VA+ACFQVQALAVEASRQK TSGPGR Sbjct: 61 PFYS-----SVAVACFQVQALAVEASRQKLTSGPGR 91 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 92.4 bits (228), Expect = 6e-17 Identities = 44/49 (89%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -3 Query: 279 VQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSVPESG-PLLSFDQRVLE 136 +QLRGPLVGPDRWWYHTLLKGTVRDTLASYGS PESG P SFDQRVLE Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLE 49 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 196 RESVTYGSFEKGVIPPPIRPDERSTELH 279 RE++TYGSFEKGV PPPIRPDERSTELH Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELH 907