BLASTX nr result
ID: Cocculus23_contig00037813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037813 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267624.1| PREDICTED: ATPase family gene 2 protein-like... 61 2e-07 >ref|XP_002267624.1| PREDICTED: ATPase family gene 2 protein-like [Vitis vinifera] Length = 516 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/57 (57%), Positives = 42/57 (73%) Frame = +3 Query: 3 RGLLSSPENWGMMSSPERTLGGKRRKERSGCETNTPSTWERKVKFLVRLKSLTKSDS 173 RGL+ SPENW SSP + + KR++ G T + S+WE+KVKFLVRL+SLTKSDS Sbjct: 458 RGLMESPENWET-SSPGKYVRKKRKE--GGSVTGSGSSWEKKVKFLVRLRSLTKSDS 511