BLASTX nr result
ID: Cocculus23_contig00037730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037730 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45841.1| hypothetical protein DOTSEDRAFT_127401 [Dothistro... 70 2e-10 gb|EMC93738.1| hypothetical protein BAUCODRAFT_36191 [Baudoinia ... 70 2e-10 >gb|EME45841.1| hypothetical protein DOTSEDRAFT_127401 [Dothistroma septosporum NZE10] Length = 139 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 318 KWSLEGRDKQLYPKETALTDDNVEPVLRLMSASGVGKDTFDIKL 187 KW+ EGRDKQL+ K+T LTDDN E VLRLM+ SG+GKDTFD+K+ Sbjct: 68 KWASEGRDKQLWVKDTLLTDDNAEAVLRLMANSGIGKDTFDVKI 111 >gb|EMC93738.1| hypothetical protein BAUCODRAFT_36191 [Baudoinia compniacensis UAMH 10762] Length = 121 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -2 Query: 318 KWSLEGRDKQLYPKETALTDDNVEPVLRLMSASGVGKDTFDIKL 187 KW+ EGRDKQL+PKET LT+DN EPVLR+M A GVGKD FDIKL Sbjct: 69 KWASEGRDKQLFPKETILTEDNCEPVLRMM-AVGVGKDVFDIKL 111