BLASTX nr result
ID: Cocculus23_contig00037632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037632 (734 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285478.2| PREDICTED: cysteinyl-tRNA synthetase-like [V... 74 4e-11 emb|CBI21127.3| unnamed protein product [Vitis vinifera] 74 4e-11 gb|EXB80733.1| Cysteine--tRNA ligase [Morus notabilis] 74 7e-11 ref|XP_006410246.1| hypothetical protein EUTSA_v10016433mg [Eutr... 74 7e-11 ref|XP_006293925.1| hypothetical protein CARUB_v10022915mg [Caps... 74 7e-11 ref|XP_006293924.1| hypothetical protein CARUB_v10022915mg [Caps... 74 7e-11 ref|XP_002881161.1| tRNA synthetase class I (C) family protein [... 74 7e-11 ref|NP_001077986.1| cysteinyl-tRNA synthetase [Arabidopsis thali... 74 7e-11 gb|AAK43958.1|AF370143_1 putative cysteinyl-tRNA synthetase [Ara... 74 7e-11 ref|NP_565717.2| cysteinyl-tRNA synthetase [Arabidopsis thaliana... 74 7e-11 ref|XP_007033894.1| Cysteinyl-tRNA synthetase, class Ia family p... 73 9e-11 ref|XP_007033893.1| Cysteinyl-tRNA synthetase, class Ia family p... 73 9e-11 ref|XP_002324312.2| hypothetical protein POPTR_0018s02040g [Popu... 73 1e-10 ref|XP_006852850.1| hypothetical protein AMTR_s00033p00195130 [A... 73 1e-10 ref|XP_006483410.1| PREDICTED: cysteine--tRNA ligase, cytoplasmi... 72 2e-10 ref|XP_006483409.1| PREDICTED: cysteine--tRNA ligase, cytoplasmi... 72 2e-10 ref|XP_006483408.1| PREDICTED: cysteine--tRNA ligase, cytoplasmi... 72 2e-10 ref|XP_006450372.1| hypothetical protein CICLE_v10008107mg [Citr... 72 2e-10 ref|XP_004291433.1| PREDICTED: cysteine--tRNA ligase-like [Fraga... 72 2e-10 ref|XP_004136364.1| PREDICTED: cysteine--tRNA ligase-like [Cucum... 72 2e-10 >ref|XP_002285478.2| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] Length = 571 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + NISY IHNG VT DS+KMSKSLGNFF Sbjct: 302 LVFPHHENEIAQSCAACKQSNISYWIHNGFVTIDSEKMSKSLGNFF 347 >emb|CBI21127.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + NISY IHNG VT DS+KMSKSLGNFF Sbjct: 205 LVFPHHENEIAQSCAACKQSNISYWIHNGFVTIDSEKMSKSLGNFF 250 >gb|EXB80733.1| Cysteine--tRNA ligase [Morus notabilis] Length = 600 Score = 73.6 bits (179), Expect = 7e-11 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + NISY +HNG VT DS+KMSKSLGNFF Sbjct: 337 LVFPHHENEIAQSCAACKQSNISYWVHNGFVTVDSEKMSKSLGNFF 382 >ref|XP_006410246.1| hypothetical protein EUTSA_v10016433mg [Eutrema salsugineum] gi|557111415|gb|ESQ51699.1| hypothetical protein EUTSA_v10016433mg [Eutrema salsugineum] Length = 578 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 308 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 353 >ref|XP_006293925.1| hypothetical protein CARUB_v10022915mg [Capsella rubella] gi|482562633|gb|EOA26823.1| hypothetical protein CARUB_v10022915mg [Capsella rubella] Length = 563 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 292 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 337 >ref|XP_006293924.1| hypothetical protein CARUB_v10022915mg [Capsella rubella] gi|482562632|gb|EOA26822.1| hypothetical protein CARUB_v10022915mg [Capsella rubella] Length = 401 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 130 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 175 >ref|XP_002881161.1| tRNA synthetase class I (C) family protein [Arabidopsis lyrata subsp. lyrata] gi|297327000|gb|EFH57420.1| tRNA synthetase class I (C) family protein [Arabidopsis lyrata subsp. lyrata] Length = 562 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 292 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 337 >ref|NP_001077986.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|330253409|gb|AEC08503.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] Length = 401 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 130 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 175 >gb|AAK43958.1|AF370143_1 putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|15293251|gb|AAK93736.1| putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|20197327|gb|AAM15026.1| putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|20197896|gb|AAD20662.2| putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] Length = 493 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 222 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 267 >ref|NP_565717.2| cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|330253408|gb|AEC08502.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] Length = 563 Score = 73.6 bits (179), Expect = 7e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 292 LVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFF 337 >ref|XP_007033894.1| Cysteinyl-tRNA synthetase, class Ia family protein, ARATH isoform 2 [Theobroma cacao] gi|508712923|gb|EOY04820.1| Cysteinyl-tRNA synthetase, class Ia family protein, ARATH isoform 2 [Theobroma cacao] Length = 477 Score = 73.2 bits (178), Expect = 9e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 303 LVFPHHENEIAQSCAACKHSNISYWIHNGFVTVDSEKMSKSLGNFF 348 >ref|XP_007033893.1| Cysteinyl-tRNA synthetase, class Ia family protein, ARATH isoform 1 [Theobroma cacao] gi|508712922|gb|EOY04819.1| Cysteinyl-tRNA synthetase, class Ia family protein, ARATH isoform 1 [Theobroma cacao] Length = 576 Score = 73.2 bits (178), Expect = 9e-11 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY IHNG VT DS+KMSKSLGNFF Sbjct: 306 LVFPHHENEIAQSCAACKHSNISYWIHNGFVTVDSEKMSKSLGNFF 351 >ref|XP_002324312.2| hypothetical protein POPTR_0018s02040g [Populus trichocarpa] gi|550317846|gb|EEF02877.2| hypothetical protein POPTR_0018s02040g [Populus trichocarpa] Length = 572 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A NISY +HNG VT DS+KMSKSLGNFF Sbjct: 301 LVFPHHENEIAQSCAACRDSNISYWVHNGFVTIDSEKMSKSLGNFF 346 >ref|XP_006852850.1| hypothetical protein AMTR_s00033p00195130 [Amborella trichopoda] gi|548856464|gb|ERN14317.1| hypothetical protein AMTR_s00033p00195130 [Amborella trichopoda] Length = 388 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A ++ NI Y IHNG VT DS+KMSKSLGNFF Sbjct: 296 LVFPHHENEIAQSCAACTESNIGYWIHNGFVTVDSEKMSKSLGNFF 341 >ref|XP_006483410.1| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like isoform X3 [Citrus sinensis] gi|568859777|ref|XP_006483411.1| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like isoform X4 [Citrus sinensis] Length = 401 Score = 72.4 bits (176), Expect = 2e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + +ISY IHNG VT DS+KMSKSLGNFF Sbjct: 130 LVFPHHENEIAQSCAACNNSHISYWIHNGFVTIDSEKMSKSLGNFF 175 >ref|XP_006483409.1| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like isoform X2 [Citrus sinensis] Length = 454 Score = 72.4 bits (176), Expect = 2e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + +ISY IHNG VT DS+KMSKSLGNFF Sbjct: 183 LVFPHHENEIAQSCAACNNSHISYWIHNGFVTIDSEKMSKSLGNFF 228 >ref|XP_006483408.1| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like isoform X1 [Citrus sinensis] Length = 574 Score = 72.4 bits (176), Expect = 2e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + +ISY IHNG VT DS+KMSKSLGNFF Sbjct: 303 LVFPHHENEIAQSCAACNNSHISYWIHNGFVTIDSEKMSKSLGNFF 348 >ref|XP_006450372.1| hypothetical protein CICLE_v10008107mg [Citrus clementina] gi|557553598|gb|ESR63612.1| hypothetical protein CICLE_v10008107mg [Citrus clementina] Length = 493 Score = 72.4 bits (176), Expect = 2e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + +ISY IHNG VT DS+KMSKSLGNFF Sbjct: 222 LVFPHHENEIAQSCAACNNSHISYWIHNGFVTIDSEKMSKSLGNFF 267 >ref|XP_004291433.1| PREDICTED: cysteine--tRNA ligase-like [Fragaria vesca subsp. vesca] Length = 552 Score = 72.4 bits (176), Expect = 2e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A + +ISY IHNG VT DS+KMSKSLGNFF Sbjct: 280 LVFPHHENEIAQSCAACKQSDISYWIHNGFVTIDSEKMSKSLGNFF 325 >ref|XP_004136364.1| PREDICTED: cysteine--tRNA ligase-like [Cucumis sativus] Length = 576 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 7 LVFPHHENKIA*SCEAYSKGNISY*IHNGLVTFDSDKMSKSLGNFF 144 LVFPHHEN+IA SC A N+SY +HNG VT DS+KMSKSLGNFF Sbjct: 305 LVFPHHENEIAQSCAACRTSNVSYWVHNGFVTIDSEKMSKSLGNFF 350