BLASTX nr result
ID: Cocculus23_contig00037409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037409 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resista... 77 2e-12 ref|XP_002319469.1| hypothetical protein POPTR_0013s00630g [Popu... 69 5e-10 ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [A... 64 2e-08 >ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resistance protein 7-like [Vitis vinifera] Length = 1538 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/60 (68%), Positives = 46/60 (76%) Frame = +1 Query: 226 LTPTFQILIKTNLSVILQAIVLGGFAGTLFYNLGGQYTQQRMNSVRALGFVSIMSVMLLN 405 +T LIK L QAI+LG F GTLFY LGG+YTQQ+MNSVRALGFVSIMSVML+N Sbjct: 606 ITKRLHALIKLRL---FQAIILGIFGGTLFYKLGGEYTQQQMNSVRALGFVSIMSVMLIN 662 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 PFVQTWWNSTKTLTNRQFRITKRLHALIKLRLFQ 104 PFVQTWW STKTL NRQ +ITKRLHALIKLRLFQ Sbjct: 587 PFVQTWWKSTKTLINRQVKITKRLHALIKLRLFQ 620 >ref|XP_002319469.1| hypothetical protein POPTR_0013s00630g [Populus trichocarpa] gi|222857845|gb|EEE95392.1| hypothetical protein POPTR_0013s00630g [Populus trichocarpa] Length = 1605 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +1 Query: 277 QAIVLGGFAGTLFYNLGGQYTQQRMNSVRALGFVSIMSVMLLN 405 + ++LG FAGTLFY LGGQY QQ+MNS+RALGFVS MS+ML+N Sbjct: 659 KVVLLGIFAGTLFYKLGGQYNQQKMNSIRALGFVSTMSIMLIN 701 >ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] gi|548843610|gb|ERN03264.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] Length = 1620 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +1 Query: 244 ILIKTNLSVILQAIVLGGFAGTLFYNLGGQYTQQRMNSVRALGFVSIMSVMLLN 405 +LIK L Q+ VLG FAGT+FY + GQY Q +MNSVRALGFVS M+VML+N Sbjct: 669 MLIKLRL---FQSTVLGLFAGTMFYKMVGQYNQMQMNSVRALGFVSTMNVMLIN 719