BLASTX nr result
ID: Cocculus23_contig00037327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037327 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME46410.1| glycoside hydrolase family 5 protein [Dothistroma... 58 1e-06 >gb|EME46410.1| glycoside hydrolase family 5 protein [Dothistroma septosporum NZE10] Length = 416 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 4/58 (6%) Frame = +1 Query: 112 MAFSQIVVAALSLLAVCTEAAPASPI----KRDNWLRFKFGQDKVRGVNLGGWFVLEP 273 M + AA LLA AAPA + KRD L+F FGQ+KVRGVNLGGWFVLEP Sbjct: 1 MGILHLATAAAGLLATIGHAAPAGLMSGFNKRD--LKFAFGQEKVRGVNLGGWFVLEP 56