BLASTX nr result
ID: Cocculus23_contig00037117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00037117 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007209284.1| hypothetical protein PRUPE_ppa008085mg [Prun... 56 4e-06 >ref|XP_007209284.1| hypothetical protein PRUPE_ppa008085mg [Prunus persica] gi|462405019|gb|EMJ10483.1| hypothetical protein PRUPE_ppa008085mg [Prunus persica] Length = 346 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/91 (34%), Positives = 50/91 (54%) Frame = +2 Query: 11 DSSSIVLELDSGDQISHREATAMEKRRNRGGSCLTPAKSEAVKESRAKKQKKCSPXXXXX 190 +SS++V +L++G+Q++ + + +KR+NR GS L A+S+A +E + KKQKK Sbjct: 80 ESSTVVDKLETGEQVTQKVTSMDKKRKNRNGSSLNSAQSKASREHKGKKQKKLD----GA 135 Query: 191 XXXXXXXXXXXXXXXXVLQESPPNGYIHVRA 283 + + PP GYIHVRA Sbjct: 136 EKAGEKKAKSDKKDQVKVGDEPPTGYIHVRA 166