BLASTX nr result
ID: Cocculus23_contig00036995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036995 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302209.2| hypothetical protein POPTR_0002s07670g [Popu... 58 2e-06 >ref|XP_002302209.2| hypothetical protein POPTR_0002s07670g [Populus trichocarpa] gi|550344493|gb|EEE81482.2| hypothetical protein POPTR_0002s07670g [Populus trichocarpa] Length = 737 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 116 AASPSPITKLGCKDKCGNVSILYPFGLGDDHKCFEEAKFKLVCN 247 AA+ PI K GC+D+CGNVSI YPFG G+D C+ ++KF + CN Sbjct: 23 AATELPIAKPGCQDRCGNVSIPYPFGTGED--CYYDSKFLITCN 64