BLASTX nr result
ID: Cocculus23_contig00036967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036967 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT04011.1| hypothetical protein FOMPIDRAFT_1014386 [Fomitops... 56 6e-06 >gb|EPT04011.1| hypothetical protein FOMPIDRAFT_1014386 [Fomitopsis pinicola FP-58527 SS1] Length = 207 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/57 (52%), Positives = 35/57 (61%) Frame = +2 Query: 92 VTANVPSAATSLASQVQSLGQSLASAATSEGGVIASDVQSFGQSIGTQVTSIGGSVY 262 V + S S+AS SLG S+AS ATS GG IASD SF I T+VTS+GG Y Sbjct: 75 VATDATSLGGSMASDATSLGGSIASQATSLGGSIASDATSFAGGIATEVTSLGGQAY 131