BLASTX nr result
ID: Cocculus23_contig00036838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036838 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71286.1| hypothetical protein M569_03473, partial [Genlise... 56 6e-06 ref|XP_007204955.1| hypothetical protein PRUPE_ppa000518mg [Prun... 56 6e-06 ref|XP_004157154.1| PREDICTED: LOW QUALITY PROTEIN: type II inos... 56 6e-06 emb|CBI23358.3| unnamed protein product [Vitis vinifera] 55 8e-06 emb|CAN64670.1| hypothetical protein VITISV_002095 [Vitis vinifera] 55 8e-06 >gb|EPS71286.1| hypothetical protein M569_03473, partial [Genlisea aurea] Length = 688 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 352 GDLWSGSEGGTIKVWSWEAMENTFFLSTDERRMA 453 GD+WSGSEGG I+VW WE++E + LS++ERRMA Sbjct: 265 GDMWSGSEGGVIRVWPWESIEKSLSLSSEERRMA 298 >ref|XP_007204955.1| hypothetical protein PRUPE_ppa000518mg [Prunus persica] gi|462400597|gb|EMJ06154.1| hypothetical protein PRUPE_ppa000518mg [Prunus persica] Length = 1116 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +1 Query: 343 SLTGDLWSGSEGGTIKVWSWEAMENTFFLSTDERRMA 453 S GDLWSGSEGG IK+W WEA+E L+T+ER M+ Sbjct: 258 SCYGDLWSGSEGGVIKIWPWEAIEKALSLTTEERHMS 294 >ref|XP_004157154.1| PREDICTED: LOW QUALITY PROTEIN: type II inositol 1,4,5-trisphosphate 5-phosphatase FRA3-like [Cucumis sativus] Length = 896 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/49 (53%), Positives = 31/49 (63%) Frame = +1 Query: 307 QSGLGLRFPAKNSLTGDLWSGSEGGTIKVWSWEAMENTFFLSTDERRMA 453 Q+ G F SL GDLWSGSEGG +KVWSWEA+E ++ E MA Sbjct: 259 QAHRGPVFSLSFSLLGDLWSGSEGGALKVWSWEAIERALSMTEGENHMA 307 >emb|CBI23358.3| unnamed protein product [Vitis vinifera] Length = 1105 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 352 GDLWSGSEGGTIKVWSWEAMENTFFLSTDERRMA 453 GDLWSGSEGG IK+W WE++E F L+ +ER MA Sbjct: 248 GDLWSGSEGGVIKIWPWESIEKVFSLTMEERHMA 281 >emb|CAN64670.1| hypothetical protein VITISV_002095 [Vitis vinifera] Length = 618 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 352 GDLWSGSEGGTIKVWSWEAMENTFFLSTDERRMA 453 GDLWSGSEGG IK+W WE++E F L+ +ER MA Sbjct: 129 GDLWSGSEGGVIKIWPWESIEKVFSLTMEERHMA 162