BLASTX nr result
ID: Cocculus23_contig00036803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036803 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298671.2| pentatricopeptide repeat-containing family p... 64 2e-08 emb|CBI25024.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_002269452.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 gb|ABF95626.1| pentatricopeptide, putative [Oryza sativa Japonic... 60 3e-07 ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004984117.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 gb|EMT02491.1| hypothetical protein F775_52486 [Aegilops tauschii] 60 4e-07 ref|XP_003557776.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 gb|EAY89771.1| hypothetical protein OsI_11313 [Oryza sativa Indi... 60 4e-07 ref|XP_007150084.1| hypothetical protein PHAVU_005G125200g [Phas... 59 5e-07 ref|XP_006663835.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 gb|EMT03352.1| hypothetical protein F775_15521 [Aegilops tauschii] 59 7e-07 ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 gb|ABA96502.1| SEC14 cytosolic factor, putative [Oryza sativa Ja... 59 7e-07 ref|XP_006605886.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_002520950.1| pentatricopeptide repeat-containing protein,... 59 7e-07 gb|ABF96424.1| pentatricopeptide, putative [Oryza sativa Japonic... 59 7e-07 ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citr... 59 9e-07 >ref|XP_002298671.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550348740|gb|EEE83476.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 634 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 FL L SI H+EIIVRD+TR+HHFKDGRCSC FW Sbjct: 600 FLKLTSSIVHKEIIVRDATRYHHFKDGRCSCNDFW 634 >emb|CBI25024.3| unnamed protein product [Vitis vinifera] Length = 621 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ L SIT REIIVRD+ RFHHFK+G CSCG FW Sbjct: 587 FMKLASSITEREIIVRDTNRFHHFKNGYCSCGEFW 621 >ref|XP_002269452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Vitis vinifera] Length = 594 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ L SIT REIIVRD+ RFHHFK+G CSCG FW Sbjct: 560 FMKLASSITEREIIVRDTNRFHHFKNGYCSCGEFW 594 >gb|ABF95626.1| pentatricopeptide, putative [Oryza sativa Japonica Group] gi|125586055|gb|EAZ26719.1| hypothetical protein OsJ_10627 [Oryza sativa Japonica Group] Length = 798 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = -2 Query: 408 LTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW--*CSNPFFQEQNGNETEVTVWHASL 235 + L+ IT REII+RD+ RFHHFKDG CSC +W PF +E + +W S+ Sbjct: 673 IKLIAKITSREIILRDANRFHHFKDGFCSCRDYWIQVSKRPFDREVHHPLQANCIW--SI 730 Query: 234 TLLRLFFSIFFIWSSVKEKAKATC 163 L R ++WS V + +K++C Sbjct: 731 VLSR-----SWVWSGVVKLSKSSC 749 >ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X2 [Citrus sinensis] Length = 610 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 408 LTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + ++ SIT REI+VRD+TR+HHFKDG+CSC FW Sbjct: 577 MKMISSITKREIVVRDATRYHHFKDGKCSCNDFW 610 >ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X1 [Citrus sinensis] Length = 623 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 408 LTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + ++ SIT REI+VRD+TR+HHFKDG+CSC FW Sbjct: 577 MKMISSITKREIVVRDATRYHHFKDGKCSCNDFW 610 >ref|XP_004984117.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Setaria italica] Length = 774 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 399 VGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + IT REIIVRDS RFHHFKDG CSCG FW Sbjct: 744 ISKITEREIIVRDSNRFHHFKDGHCSCGDFW 774 >gb|EMT02491.1| hypothetical protein F775_52486 [Aegilops tauschii] Length = 1090 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/78 (35%), Positives = 44/78 (56%) Frame = -2 Query: 408 LTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW*CSNPFFQEQNGNETEVTVWHASLTL 229 + ++ I +R+IIVRDS+RFHHFKDG CSCG +W + ++ ++ W S Sbjct: 833 IKMMSKIVNRDIIVRDSSRFHHFKDGVCSCGDYWMHTEHADKQLRIVRAHLSGWSDSA-- 890 Query: 228 LRLFFSIFFIWSSVKEKA 175 +FF+WS+ K + Sbjct: 891 ----IDVFFLWSTKKNSS 904 >ref|XP_003557776.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Brachypodium distachyon] Length = 747 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 399 VGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + IT REIIVRDS RFHHFKDG CSCG FW Sbjct: 717 ISQITEREIIVRDSNRFHHFKDGHCSCGDFW 747 >gb|EAY89771.1| hypothetical protein OsI_11313 [Oryza sativa Indica Group] Length = 798 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Frame = -2 Query: 408 LTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW--*CSNPFFQEQNGNETEVTVWHASL 235 + L+ IT REI++RD+ RFHHFKDG CSC +W PF +E + +W S+ Sbjct: 673 IKLIAKITSREIVLRDANRFHHFKDGFCSCRDYWIQVSKRPFDREVHHPLQANCIW--SI 730 Query: 234 TLLRLFFSIFFIWSSVKEKAKATC 163 L R ++WS V + +K++C Sbjct: 731 VLSR-----SWVWSGVVKLSKSSC 749 >ref|XP_007150084.1| hypothetical protein PHAVU_005G125200g [Phaseolus vulgaris] gi|561023348|gb|ESW22078.1| hypothetical protein PHAVU_005G125200g [Phaseolus vulgaris] Length = 876 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ LV I HR I+VRDS RFHHFKDG CSCG +W Sbjct: 842 FIKLVSLIEHRYIVVRDSNRFHHFKDGLCSCGDYW 876 >ref|XP_006663835.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Oryza brachyantha] Length = 630 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ +V IT R+IIVRD RFHHFKDG CSCG FW Sbjct: 596 FMKIVSCITERKIIVRDINRFHHFKDGSCSCGDFW 630 >ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Oryza brachyantha] Length = 749 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 399 VGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + IT REIIVRDS RFHHFKDG CSCG FW Sbjct: 719 ISKITEREIIVRDSNRFHHFKDGYCSCGDFW 749 >gb|EMT03352.1| hypothetical protein F775_15521 [Aegilops tauschii] Length = 446 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ L I EIIVRD+ RFHHFKDG CSCGGFW Sbjct: 412 FMRLASRIEQAEIIVRDNMRFHHFKDGECSCGGFW 446 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 402 LVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 L+ IT REIIVRDS RFHHFKDG CSCG +W Sbjct: 836 LISVITEREIIVRDSNRFHHFKDGTCSCGDYW 867 >gb|ABA96502.1| SEC14 cytosolic factor, putative [Oryza sativa Japonica Group] gi|125535837|gb|EAY82325.1| hypothetical protein OsI_37535 [Oryza sativa Indica Group] gi|125578563|gb|EAZ19709.1| hypothetical protein OsJ_35285 [Oryza sativa Japonica Group] Length = 630 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ +V IT R++IVRD RFHHFKDG CSCG FW Sbjct: 596 FMKIVSCITERQVIVRDINRFHHFKDGSCSCGDFW 630 >ref|XP_006605886.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] Length = 618 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F+ LV T REIIVRD+ RFHHFKDG CSCG FW Sbjct: 584 FMKLVSKSTSREIIVRDTNRFHHFKDGFCSCGEFW 618 >ref|XP_002520950.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539787|gb|EEF41367.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 835 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -2 Query: 411 FLTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 F TLV RE+IVRD++RFHHFKDG CSCG FW Sbjct: 801 FCTLVSRFFERELIVRDASRFHHFKDGMCSCGDFW 835 >gb|ABF96424.1| pentatricopeptide, putative [Oryza sativa Japonica Group] gi|125586550|gb|EAZ27214.1| hypothetical protein OsJ_11153 [Oryza sativa Japonica Group] Length = 748 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 399 VGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + IT REIIVRDS RFHHFKDG CSCG FW Sbjct: 718 ISKITEREIIVRDSNRFHHFKDGYCSCGDFW 748 >ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] gi|557522907|gb|ESR34274.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] Length = 610 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -2 Query: 408 LTLVGSITHREIIVRDSTRFHHFKDGRCSCGGFW 307 + ++ +IT REI+VRD+TR+HHFKDG+CSC FW Sbjct: 577 MKMISNITKREIVVRDATRYHHFKDGKCSCNDFW 610