BLASTX nr result
ID: Cocculus23_contig00036750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036750 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 58 1e-06 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 3/68 (4%) Frame = -3 Query: 324 DNIPLPLVGVGSLLHHTCSF*GIF-IPNLNLNLICIGQLCDFGYFIHPYPS--CHVLDLH 154 D P+PL GVGS++ S ++ IP L LNL IGQ+CD G ++ + C V DL Sbjct: 374 DGTPMPLAGVGSVVTLHLSLPNVYLIPKLKLNLASIGQICDSGDYLVMFSGSFCCVQDLQ 433 Query: 153 SQKLIGTG 130 SQKLIGTG Sbjct: 434 SQKLIGTG 441