BLASTX nr result
ID: Cocculus23_contig00036744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036744 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS36015.1| hypothetical protein H072_10403 [Dactylellina hap... 60 2e-07 ref|XP_007585459.1| putative carrier protein [Neofusicoccum parv... 60 2e-07 ref|XP_001244490.1| ADP/ATP carrier protein [Coccidioides immiti... 60 2e-07 gb|EMD00490.1| hypothetical protein BAUCODRAFT_28844 [Baudoinia ... 60 4e-07 gb|EHY55733.1| ADP,ATP carrier protein, variant [Exophiala derma... 60 4e-07 ref|XP_002837794.1| ADP/ATP carrier protein [Tuber melanosporum ... 60 4e-07 ref|XP_003304315.1| ADP/ATP carrier protein [Pyrenophora teres f... 59 5e-07 ref|XP_001934086.1| ADP/ATP carrier protein [Pyrenophora tritici... 59 5e-07 gb|EXJ77452.1| ADP,ATP carrier protein [Capronia epimyces CBS 60... 59 7e-07 gb|EWC48323.1| ADP,ATP carrier protein [Drechslerella stenobroch... 59 7e-07 gb|ERF71418.1| ADP, ATP carrier protein [Endocarpon pusillum Z07... 59 7e-07 gb|EGX53383.1| hypothetical protein AOL_s00006g249 [Arthrobotrys... 59 7e-07 ref|XP_002542493.1| ADP,ATP carrier protein [Uncinocarpus reesii... 59 7e-07 gb|EUC36268.1| hypothetical protein COCCADRAFT_23866 [Bipolaris ... 59 9e-07 gb|EOA88597.1| hypothetical protein SETTUDRAFT_107517 [Setosphae... 59 9e-07 gb|EMD87278.1| hypothetical protein COCHEDRAFT_1023464 [Bipolari... 59 9e-07 gb|EMD59865.1| hypothetical protein COCSADRAFT_29936 [Bipolaris ... 59 9e-07 gb|EXJ82040.1| ADP,ATP carrier protein [Capronia coronata CBS 61... 58 2e-06 ref|XP_003667288.1| hypothetical protein MYCTH_2316753 [Myceliop... 58 2e-06 ref|XP_006692040.1| putative ADP/ATP carrier protein [Chaetomium... 58 2e-06 >gb|EPS36015.1| hypothetical protein H072_10403 [Dactylellina haptotyla CBS 200.50] Length = 306 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKAYKGGSG Sbjct: 277 LRGVAGAGVLSIYDQVQLLLFGKAYKGGSG 306 >ref|XP_007585459.1| putative carrier protein [Neofusicoccum parvum UCRNP2] gi|485921313|gb|EOD47064.1| putative carrier protein [Neofusicoccum parvum UCRNP2] Length = 320 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKAYKGGSG Sbjct: 291 LRGVAGAGVLSIYDQVQLLLFGKAYKGGSG 320 >ref|XP_001244490.1| ADP/ATP carrier protein [Coccidioides immitis RS] gi|303316782|ref|XP_003068393.1| ADP/ATP carrier protein [Coccidioides posadasii C735 delta SOWgp] gi|240108074|gb|EER26248.1| ADP,ATP carrier protein, putative [Coccidioides posadasii C735 delta SOWgp] gi|320038234|gb|EFW20170.1| mitochondrial ADP,ATP carrier protein [Coccidioides posadasii str. Silveira] gi|392871208|gb|EAS33091.2| ADP,ATP carrier protein [Coccidioides immitis RS] Length = 319 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKAYKGGSG Sbjct: 290 LRGVAGAGVLSIYDQVQLLLFGKAYKGGSG 319 >gb|EMD00490.1| hypothetical protein BAUCODRAFT_28844 [Baudoinia compniacensis UAMH 10762] Length = 319 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQLL+FGKA+KGGSG Sbjct: 290 LRGVAGAGVLSIYDQAQLLMFGKAFKGGSG 319 >gb|EHY55733.1| ADP,ATP carrier protein, variant [Exophiala dermatitidis NIH/UT8656] gi|378729275|gb|EHY55734.1| ADP,ATP carrier protein [Exophiala dermatitidis NIH/UT8656] Length = 318 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLL+FGKAYKGGSG Sbjct: 289 LRGVAGAGVLSIYDQVQLLMFGKAYKGGSG 318 >ref|XP_002837794.1| ADP/ATP carrier protein [Tuber melanosporum Mel28] gi|295633677|emb|CAZ81985.1| unnamed protein product [Tuber melanosporum] Length = 307 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLL+FGKAYKGGSG Sbjct: 278 LRGVAGAGVLSIYDQVQLLMFGKAYKGGSG 307 >ref|XP_003304315.1| ADP/ATP carrier protein [Pyrenophora teres f. teres 0-1] gi|311319147|gb|EFQ87592.1| hypothetical protein PTT_16860 [Pyrenophora teres f. teres 0-1] Length = 349 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQL+LFGK YKGGSG Sbjct: 320 LRGVAGAGVLSIYDQAQLILFGKKYKGGSG 349 >ref|XP_001934086.1| ADP/ATP carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979965|gb|EDU46591.1| ADP,ATP carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 313 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQL+LFGK YKGGSG Sbjct: 284 LRGVAGAGVLSIYDQAQLILFGKKYKGGSG 313 >gb|EXJ77452.1| ADP,ATP carrier protein [Capronia epimyces CBS 606.96] Length = 267 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKA+KGGSG Sbjct: 238 LRGVAGAGVLSIYDQVQLLLFGKAFKGGSG 267 >gb|EWC48323.1| ADP,ATP carrier protein [Drechslerella stenobrocha 248] Length = 306 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKA+KGGSG Sbjct: 277 LRGVAGAGVLSIYDQVQLLLFGKAFKGGSG 306 >gb|ERF71418.1| ADP, ATP carrier protein [Endocarpon pusillum Z07020] Length = 316 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKA+KGGSG Sbjct: 287 LRGVAGAGVLSIYDQVQLLLFGKAFKGGSG 316 >gb|EGX53383.1| hypothetical protein AOL_s00006g249 [Arthrobotrys oligospora ATCC 24927] Length = 306 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKA+KGGSG Sbjct: 277 LRGVAGAGVLSIYDQVQLLLFGKAFKGGSG 306 >ref|XP_002542493.1| ADP,ATP carrier protein [Uncinocarpus reesii 1704] gi|237902759|gb|EEP77160.1| ADP,ATP carrier protein [Uncinocarpus reesii 1704] Length = 269 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ QLLLFGKA+KGGSG Sbjct: 240 LRGVAGAGVLSIYDQVQLLLFGKAFKGGSG 269 >gb|EUC36268.1| hypothetical protein COCCADRAFT_23866 [Bipolaris zeicola 26-R-13] gi|576930572|gb|EUC44150.1| hypothetical protein COCMIDRAFT_98907 [Bipolaris oryzae ATCC 44560] gi|578485059|gb|EUN22565.1| hypothetical protein COCVIDRAFT_30448 [Bipolaris victoriae FI3] Length = 316 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQLLLFGK +KGGSG Sbjct: 287 LRGVAGAGVLSIYDQAQLLLFGKKFKGGSG 316 >gb|EOA88597.1| hypothetical protein SETTUDRAFT_107517 [Setosphaeria turcica Et28A] Length = 316 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQLLLFGK +KGGSG Sbjct: 287 LRGVAGAGVLSIYDQAQLLLFGKKFKGGSG 316 >gb|EMD87278.1| hypothetical protein COCHEDRAFT_1023464 [Bipolaris maydis C5] gi|477583228|gb|ENI00328.1| hypothetical protein COCC4DRAFT_65490 [Bipolaris maydis ATCC 48331] Length = 316 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQLLLFGK +KGGSG Sbjct: 287 LRGVAGAGVLSIYDQAQLLLFGKKFKGGSG 316 >gb|EMD59865.1| hypothetical protein COCSADRAFT_29936 [Bipolaris sorokiniana ND90Pr] Length = 316 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQLLLFGK +KGGSG Sbjct: 287 LRGVAGAGVLSIYDQAQLLLFGKKFKGGSG 316 >gb|EXJ82040.1| ADP,ATP carrier protein [Capronia coronata CBS 617.96] Length = 318 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQAQLL+FGK +KGGSG Sbjct: 289 LRGVAGAGVLSIYDQAQLLIFGKKFKGGSG 318 >ref|XP_003667288.1| hypothetical protein MYCTH_2316753 [Myceliophthora thermophila ATCC 42464] gi|347014561|gb|AEO62043.1| hypothetical protein MYCTH_2316753 [Myceliophthora thermophila ATCC 42464] Length = 315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ Q+LLFGKA+KGGSG Sbjct: 286 LRGVAGAGVLSIYDQLQILLFGKAFKGGSG 315 >ref|XP_006692040.1| putative ADP/ATP carrier protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340975933|gb|EGS23048.1| putative ADP/ATP carrier protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 LRGVAGAGVLSIYDQAQLLLFGKAYKGGSG 90 LRGVAGAGVLSIYDQ Q+LLFGKA+KGGSG Sbjct: 286 LRGVAGAGVLSIYDQLQILLFGKAFKGGSG 315