BLASTX nr result
ID: Cocculus23_contig00036624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00036624 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446463.1| hypothetical protein SORBIDRAFT_06g016400 [S... 56 6e-06 >ref|XP_002446463.1| hypothetical protein SORBIDRAFT_06g016400 [Sorghum bicolor] gi|241937646|gb|EES10791.1| hypothetical protein SORBIDRAFT_06g016400 [Sorghum bicolor] Length = 998 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +2 Query: 2 EYFNMNRADEMSRALLYREFPEHFVWNHQARIWMQMKK 115 EYFNMNR D +R LLYREFPEH+ W ++W + KK Sbjct: 317 EYFNMNRTDSFARTLLYREFPEHYRWISGRKVWQRRKK 354